(data stored in ACNUC7421 zone)

EMBL: Z34005

ID   Z34005; SV 1; linear; genomic DNA; STD; PRO; 1935 BP.
XX
AC   Z34005;
XX
DT   31-MAY-1994 (Rel. 39, Created)
DT   14-NOV-2006 (Rel. 89, Last updated, Version 8)
XX
DE   B.subtilis tlpC gene
XX
KW   methylation enzyme; tlpC gene.
XX
OS   Bacillus subtilis
OC   Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
XX
RN   [1]
RP   159-1872
RX   PUBMED; 7921238.
RA   Hanlon D., Rosario M.M.L., Ordal G.W., Venema G., Van Sinderen D.;
RT   "Identification of TlpC, a novel 62 kDa MCP-like protein from Bacillus
RT   subtilis";
RL   Microbiology (Reading, Engl.) 140:1847-1854(1994).
XX
RN   [2]
RP   1-1935
RA   Van Sinderen D.;
RT   ;
RL   Submitted (31-MAY-1994) to the INSDC.
RL   van Sinderen D., University of Illinois, College of medicine at
RL   urbana-champaign, 506 South Mathews, Urbana, Ireland, IL 61801
XX
DR   MD5; 4ff2dfeb1c12a5c66a63d931286df163.
DR   GOA; P42404.
DR   InterPro; IPR001347; SIS.
DR   InterPro; IPR017552; PHI/rmpB.
DR   PDB; 1M3S; X-ray.
DR   PDB; 1VIV; X-ray.
DR   UniProtKB/Swiss-Prot; P42404; PHI_BACSU.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1935
FT                   /organism="Bacillus subtilis"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:1423"
FT   regulatory      91..95
FT                   /regulatory_class="minus_35_signal"
FT   regulatory      113..119
FT                   /regulatory_class="minus_10_signal"
FT   regulatory      145..149
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        155..1876
FT                   /transl_table=11
FT                   /gene="tlpC"
FT                   /function="methylation enzyme"
FT                   /note="label:TlpC"
FT                   /db_xref="GOA:P39209"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033463"
FT                   /db_xref="UniProtKB/Swiss-Prot:P39209"
FT                   /protein_id="CAA83970.1"
FT                   /translation="MLIKRFKMKLGTKILCLVFVVILLFSASVGTVMLKEITESMKQMA
FT                   TEKAKGDLALSSTYIDDVMSGDWQVKNNKLYKGQTQINGNEDIVDLLGEKTGDTITIFQ
FT                   GDTRVATNVMKNGERAVGTQASSEVIAAVLKKGKRFYGQADVAGSSYQTAYMPLKDQNG
FT                   NIIGMLYTGANQSILASLTQSLFTQFAIVLVIVIMVSVILVLVFTRKINKRLNALKSAF
FT                   ESAGNGDMTIEVSDKTGDELSELSVYYNKMRMKLNDTIQTVQQSALQLASASQQLSAGA
FT                   EETNQASEKITEAVQQIANGAQDQITRIENSESSLKQASADIRDISANTAAIADKGQLA
FT                   QSKADIGQKEIANVQAQMDAIHQSIQKSGEIIHQLDGRSKQIEQILSVITQIADQTNLL
FT                   ALNAAIEAARAGEQGKGFAVVADEVRKLAEESQQSAGQISKLIIEIQKDMNRSARSVEH
FT                   VKTEAAEGVTMIQRTRDAFKEIAAATGEISAEISDLSASVTNISASAHQINDSFAANTA
FT                   DIKESTKNTRQAAALTEEQFAAMEEITAASETLSQLAEELTGIISQFKMINQAENG"
XX
SQ   Sequence 1935 BP; 661 A; 395 C; 409 G; 470 T; 0 other;
     tcgattctga aactatgttc actcaccacg caaaccttga atagcatcac acaaccggcc        60
     tgaagatcag gccggtttta ttttttctaa aataaaactt taaacccaaa aacccgataa       120
     gtaatatgac ctgcaaatcg taaagggagg aattatgttg ataaaacgat ttaagatgaa       180
     gctaggaact aaaattcttt gcctcgtttt cgtggtgatt cttttgtttt cggcatcagt       240
     tggcactgtg atgcttaagg aaattacaga aagcatgaaa caaatggcaa ctgaaaaagc       300
     gaaaggtgat ctcgctttaa gcagcactta tattgatgat gtcatgtcag gcgactggca       360
     ggtgaaaaac aataagctct ataaagggca aacacaaatc aatggaaatg aagatattgt       420
     tgatctgctt ggtgaaaaga caggtgatac cattaccatt ttccaaggcg atactcgtgt       480
     tgcaaccaat gtcatgaaaa atggcgaaag agccgtcggc acccaggctt cttctgaagt       540
     tattgccgct gttttaaaga aaggaaagcg tttttacgga caagcagatg tagcaggttc       600
     ttcttatcag actgcataca tgccgttaaa agatcaaaat gggaacatca tcggcatgct       660
     gtataccgga gctaatcaaa gtattttagc atcacttaca caatcacttt tcactcaatt       720
     cgctatcgtt cttgttatcg tcattatggt atcagtcatc cttgtcttgg ttttcaccag       780
     aaaaatcaac aagcggctga acgctttaaa aagcgccttt gaaagtgccg gaaacggaga       840
     tatgacaata gaggtgtcag acaaaaccgg tgacgagctt tcagaactaa gcgtctatta       900
     taataagatg agaatgaagc tgaacgatac catacaaacc gtacaacaat cagcccttca       960
     gcttgcgtca gcctctcagc agctctcagc cggagcagag gaaacaaatc aagcttcaga      1020
     aaaaatcaca gaagctgtac agcagattgc aaatggagcc caagatcaga tcacccgaat      1080
     tgaaaatagt gaaagctcat taaaacaagc ttcagcagac atccgggata tttctgcaaa      1140
     tactgccgct atcgctgaca aagggcagct cgctcaatca aaagcagaca ttggacaaaa      1200
     ggaaattgca aatgtacagg cgcaaatgga tgcgattcac cagtcaattc agaaaagcgg      1260
     agaaatcata caccagttag acggccgctc taaacaaatt gagcaaattt tatcggtcat      1320
     cacccaaatt gctgatcaga caaacctgct tgcgctgaat gcagcgattg aagctgccag      1380
     agccggtgaa caaggaaaag gctttgctgt tgttgctgat gaagtacgga aattagcaga      1440
     agagtctcaa cagtctgcgg ggcagatttc aaaactgatc atagaaatac aaaaggatat      1500
     gaaccggtct gcaagatctg ttgagcatgt gaaaacagaa gctgcagaag gagtcaccat      1560
     gatccagcgc accagagatg catttaagga aattgcagct gcaacaggtg aaatcagcgc      1620
     cgagattagt gatttatcag catctgtaac aaacatttca gccagtgcac atcaaataaa      1680
     tgattccttt gcagccaata cggccgacat taaagaatct actaaaaata cccggcaagc      1740
     ggctgcatta acagaggagc aatttgctgc aatggaggag attaccgcag cttctgaaac      1800
     actttctcaa ttagctgagg agcttaccgg tatcataagc caatttaaaa tgattaatca      1860
     agccgaaaac ggctgatgac ttactatcat tattgtaaat tggcaatcgt attttgctga      1920
     aaacaaatat ttcga                                                       1935
//

If you have problems or comments...

PBIL Back to PBIL home page