(data stored in ACNUC7421 zone)

EMBL: Z38117

ID   Z38117; SV 1; linear; mRNA; STD; MUS; 3185 BP.
XX
AC   Z38117;
XX
DT   06-FEB-1997 (Rel. 50, Created)
DT   18-APR-2005 (Rel. 83, Last updated, Version 11)
XX
DE   M.musculus mRNA for dead-box RNA helicase
XX
KW   dead-box protein; RNA helicase.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3185
RX   PUBMED; 8948440.
RA   Sowden J.C., Putt W., Morrison K., Beddington R., Edwards Y.;
RT   "The embryonic RNA helicase gene (ERH): a new member of the DEAD box family
RT   of RNA helicases";
RL   Biochem. J. 308:839-846(1995).
XX
RN   [2]
RP   1-3185
RA   Edwards Y.H.;
RT   ;
RL   Submitted (13-OCT-1994) to the INSDC.
RL   Yvonne H Edwards Dr, Wolfson House, MRC Human Biochemical Genetics Unit
RL   UCL, 4 Stephenson Way, London, England, NW1 2HE, UK
XX
RN   [3]
RX   DOI; 10.1007/s003359900344.
RX   PUBMED; 9021147.
RA   Sowden J., Morrison K., Putt W., Beddington R., Edwards Y.;
RT   "The identification of novel sequences expressed in the mouse notochord";
RL   Mamm. Genome 8(1):42-44(1997).
XX
DR   MD5; 0b0d18a02bc7e1bb78c6880bef8ba6d9.
DR   Ensembl-Gn; ENSMUSG00000000787; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0035571; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0035549; mus_musculus_aj.
DR   Ensembl-Gn; MGP_BALBcJ_G0035542; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0036071; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034550; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0035227; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0035380; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0035327; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0035462; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0035370; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0036083; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0034686; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000000804; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0095689; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0095776; mus_musculus_aj.
DR   Ensembl-Tr; MGP_BALBcJ_T0095693; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0096214; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0095870; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0095184; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0095387; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0095234; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0095408; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0095212; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0096545; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0094252; mus_musculus_wsbeij.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3185
FT                   /organism="Mus musculus"
FT                   /chromosome="1"
FT                   /strain="c57bl/6"
FT                   /mol_type="mRNA"
FT                   /dev_stage="9.5dpc"
FT                   /clone_lib="lambda pExcell not-cDNA lib from Sowden &
FT                   Edwards"
FT                   /clone="cl14"
FT                   /cell_type="notochord"
FT                   /tissue_type="notochord"
FT                   /db_xref="taxon:10090"
FT   CDS_pept        76..2064
FT                   /product="dead-box RNA helicase"
FT                   /db_xref="GOA:Q62167"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:103064"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q62167"
FT                   /protein_id="CAA86261.1"
FT                   /translation="MSHVAVENALGLDQQFAGLDLNSSDNQSGGSTASKGRYIPPHLRN
FT                   REATKGFYDKDSSGWSSSKDKDAYSSFGSRGDSRGKSSFFGDRGSGSRGRFDDRGRGDY
FT                   DGIGGRGDRSGFGKFERGGNSRWCDKSDEDDWSKPLPPSERLEQELFSGGNTGINFEKY
FT                   DDIPVEATGNNCPPHIESFSDVEMGEIIMGNIELTRYTRPTPVQKHAIPIIKEKRDLMA
FT                   CAQTGSGKTAAFLLPILSQIYADGPGEALRAMKENGRYGRRKQYPISLVLAPTRELAVQ
FT                   IYEEARKFSYRSRVRPCVVYGGAEIGQQIRDLERGCHLLVATPGRLVDMMERGKIGLDF
FT                   CKYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGVRHTMMFSATFPKEIQMLARDFLDE
FT                   YIFLAVGRVGSTSENITQKVVWVEEIDKRSFLLDLLNATGKDSLTLVFVETKKGADSLE
FT                   DFLYHEGYACTSIHGDRSQRDREEALHQFRSGKSPILVATAVAARGLDISNVKHVINFD
FT                   LPSDIEEYVHRIGRTGRVGNLGLATSFFNERNINITKDLLDLLVEAKQEVPSWLENMAF
FT                   EHHYKGSSRGRSKSSRFSGGFGARDYRQSSGASSSSFSSSRASSSRSGGGGHGGSRGFG
FT                   GGGYGGFYNSDGYGGNYNSQGVDWWGN"
XX
SQ   Sequence 3185 BP; 934 A; 587 C; 800 G; 864 T; 0 other;
     cgtgagaggg cctttgcggt agaggcagcc tttgctcagc agcggaagac tccgatttct        60
     cggtactctt cagggatgag tcatgtggca gtggaaaatg cgctcgggct ggaccagcag       120
     tttgctggcc tagacctgaa ctcttcagat aatcagagtg gaggaagtac agcaagcaaa       180
     gggcgttata tcccacctca tttaaggaac agagaagcta ctaaaggatt ctatgacaaa       240
     gacagttcag ggtggagttc tagtaaagat aaggatgcat acagcagttt tggatcacgg       300
     ggtgattcaa gagggaagtc tagcttcttt ggagatcgtg gaagtggatc aaggggaagg       360
     tttgatgatc gtggacgggg agactatgat ggcattggtg gccgtggaga tagaagtggc       420
     tttggcaaat ttgaaagagg tggaaatagt cgctggtgtg acaaatcaga tgaagatgac       480
     tggtcaaagc cactcccacc aagtgaacga ttggaacagg aactcttttc tggaggcaat       540
     actgggatta actttgagaa atatgatgac attccagtcg aagcaacagg caacaactgt       600
     cctccacaca ttgaaagttt cagtgatgtc gagatgggag aaattattat gggaaacatt       660
     gagcttactc gttatactcg cccaactcca gtgcagaagc atgctattcc tattatcaaa       720
     gagaaaagag acttgatggc ttgtgctcaa acaggctctg gaaaaactgc agcatttctc       780
     ttgcccatct tgagtcagat ctatgctgat ggtccaggag aagctctgag ggctatgaag       840
     gaaaatggaa gatatggccg tcgtaaacag tatccaatct ctttggtact ggcaccaacg       900
     agagaattgg cagtgcagat ctatgaggaa gccagaaaat tctcataccg atctagagtc       960
     cgtccttgcg tggtttatgg tggtgctgaa attggccagc agattcgaga cttagaacgt      1020
     ggatgccact tgttagtagc cactccagga cgtctagtgg atatgatgga gagagggaag      1080
     atcgggttag acttctgcaa atacctggtg ttagatgaag ctgaccggat gttagatatg      1140
     gggtttgaac ctcagatacg aagaatagtt gaacaagaca ctatgcctcc aaaaggtgtc      1200
     cgccacacta tgatgtttag tgctactttt cctaaggaaa tacagatgct ggcccgtgat      1260
     ttcttagatg agtacatatt tctggctgta ggaagagttg ggtctacttc agagaacatc      1320
     acacaaaaag tggtttgggt ggaggagata gacaaaaggt catttctgct tgaccttcta      1380
     aatgcaacag gcaaggattc cctgactcta gtgtttgtgg agaccaaaaa gggggcagat      1440
     tcgctggagg atttcttata ccatgaagga tatgcttgta ccagtatcca tggagaccgt      1500
     tctcagagag atagggaaga ggcccttcac cagttccgct caggaaaaag cccaattcta      1560
     gtggctacag cagtagcagc aagaggactg gatatttcaa atgtgaagca tgttattaat      1620
     tttgacctgc ctagtgatat cgaagaatat gtgcatcgca taggccgtac aggccgtgtg      1680
     ggaaaccttg gtcttgccac ctcattcttt aatgaaagga atataaatat cacaaaggat      1740
     ttactggatc ttcttgttga agcaaaacaa gaagtgcctt cttggttaga gaacatggct      1800
     tttgaacacc actacaaggg tagcagtcgt ggacgttcta agagcagtcg atttagtgga      1860
     gggtttggtg ccagagacta ccgacagagt agcggtgcca gcagttccag cttcagcagc      1920
     agccgtgcaa gcagcagtcg aagtggtgga ggtggccatg gcggcagtcg aggatttggt      1980
     ggaggtggct acggaggctt ttacaacagt gatggatatg gagggaatta taactcccag      2040
     ggggttgact ggtggggtaa ctgagcctgc tctgtagtag gtcaccctgc caaacaagct      2100
     aatatggaaa ccacatgtaa cttagccaga ctataccttg tgtagcttca agaactcgca      2160
     gtacattacc agctgtgatt ctccactgaa attttttttt aagggagctc aaggtcacaa      2220
     gtaaagatga aaggaacaat cagcagccct gtctgaaggt ggtttgaaga cttcattgct      2280
     gtagtttgga ttaacgcccc tcccgcctac ccctatccca aactgcattt ataattttgt      2340
     gactgaggat catttgtttg ttaatgtact gtgcctttaa ctttagacaa ctttttattt      2400
     tgatgtcctg ttggctcagt aatgctcaag attccaattg tttttgacaa aataaattta      2460
     ctgaacttgg gctaaaatca aaccttggca cacaggtgtg atacaactta acaggaatca      2520
     tcgattcatc cataaataat ataaggaaaa actcaagtgg tagcctgtct taaggctttt      2580
     gatacttgca gattggggaa aaacaaacaa caaacgtctt gaagcatatt aatggaatta      2640
     gtttctaatg tggcaaactg tattaagtta aaagttctga tttgctcact ctatcctgta      2700
     taggtattta gaacctgata atagtcttta aacaagccat tccagtcatg atgaggtgat      2760
     gtatggatac atgcatacat tcaaagcact gttctcaaag ttaatgcaag taaatacagc      2820
     aattcctctt tcaatgttta ggcagatcgt taactatgag ctagccaaat gtgggcatgt      2880
     tattacaggg aaagtttaaa ggtctgataa cttgaaatag gtttaggaga attcatctac      2940
     ttagactttt taaatgcctg ccataaaaaa ttgaaatggt agaatggctg accacagcaa      3000
     tgaccagccc tcacctaggg ctctggatga tttttggtct aataacgcat gctagtgttg      3060
     atgttttttg gtcaagatgg gaatgaacag gaagaattat gcagcaggct ttattttaaa      3120
     tgccgattca cattactctg ttcaagctgc gttgagatgt taaactggct tactatagac      3180
     tttgt                                                                  3185
//

If you have problems or comments...

PBIL Back to PBIL home page