(data stored in ACNUC8465 zone)

EMBL: Z49944

ID   Z49944; SV 1; linear; mRNA; STD; MAM; 595 BP.
XX
AC   Z49944;
XX
DT   29-JUN-1995 (Rel. 44, Created)
DT   18-APR-2005 (Rel. 83, Last updated, Version 3)
XX
DE   C.familiaris mRNA for CDC42 GTP-binding protein.
XX
KW   CDC42; GTP-binding protein.
XX
OS   Canis lupus familiaris (dog)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Laurasiatheria; Carnivora; Caniformia; Canidae; Canis.
XX
RN   [1]
RP   14-587
RA   Dutartre H., Davoust J., Gorvel J., Chavrier P.;
RT   "Cytokinesis arrest and redistribution of actin-cytoskeleton regulatory
RT   components induced by the Rho GTPase CDC42Hs";
RL   Unpublished.
XX
RN   [2]
RP   1-595
RA   Chavrier P.;
RT   ;
RL   Submitted (26-JUN-1995) to the INSDC.
RL   Philippe Chavrier, Centre d'Immunologie INSERM/CNRS de Marseille, Luminy,
RL   Parc scientifique de Luminy. Case 906, Marseille, 13288, cedex 9, France
XX
DR   MD5; 2257c7f3551801fe2862a2ff68d946b0.
DR   Ensembl-Gn; ENSCAFG00000014707; canis_familiaris.
DR   Ensembl-Tr; ENSCAFT00000023350; canis_familiaris.
DR   Ensembl-Tr; ENSCAFT00000023351; canis_familiaris.
DR   EuropePMC; PMC98957; 10066831.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..595
FT                   /organism="Canis lupus familiaris"
FT                   /strain="cocker spaniel"
FT                   /mol_type="mRNA"
FT                   /cell_line="Mardin Dabey Kidney Cell (MDCK)"
FT                   /db_xref="taxon:9615"
FT   CDS_pept        14..589
FT                   /product="CDC42 GTP-binding protein"
FT                   /db_xref="GOA:P60952"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR003578"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037874"
FT                   /db_xref="UniProtKB/Swiss-Prot:P60952"
FT                   /protein_id="CAA90215.1"
FT                   /translation="MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVM
FT                   IGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHH
FT                   CPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQK
FT                   GLKNVFDEAILAALEPPEPKKSRRCVLL"
XX
SQ   Sequence 595 BP; 165 A; 135 C; 141 G; 154 T; 0 other;
     ggaattcgcc accatgcaga caattaagtg cgttgttgtg ggcgatggtg ccgttggtaa        60
     aacatgtctc ctgatatcct acacaacaaa caaatttcca tctgagtatg taccgactgt       120
     ttttgacaac tatgcagtca cggttatgat tggtggagag ccatataccc ttggactttt       180
     tgatactgca gggcaagagg attatgacag attacgaccg ctgagttatc cacaaacaga       240
     tgtatttcta gtctgttttt cagtggtctc tccatcctca tttgaaaatg tgaaggaaaa       300
     gtgggtgcct gagataactc accactgtcc aaagactcct ttcttgcttg ttgggaccca       360
     aattgatctc cgagatgacc cctctactat cgagaaactt gccaagaaca aacagaagcc       420
     tatcactcca gagactgctg aaaagctggc ccgtgacctg aaggcggtca agtatgtgga       480
     gtgttctgca ctcacacaga aaggcctaaa gaatgtattt gacgaagcaa tattggctgc       540
     cctggagcct ccagaaccga agaagagccg caggtgtgtg ctgctatgag gatcc            595
//

If you have problems or comments...

PBIL Back to PBIL home page