(data stored in ACNUC8465 zone)

EMBL: Z69980

ID   Z69980; SV 1; linear; mRNA; STD; INV; 414 BP.
XX
AC   Z69980;
XX
DT   08-MAR-1996 (Rel. 47, Created)
DT   18-APR-2005 (Rel. 83, Last updated, Version 10)
XX
DE   A.gambiae mRNA for GTP-binding protein (partial)
XX
KW   GTP-binding protein.
XX
OS   Anopheles gambiae (African malaria mosquito)
OC   Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota;
OC   Neoptera; Holometabola; Diptera; Nematocera; Culicoidea; Culicidae;
OC   Anophelinae; Anopheles.
XX
RN   [2]
RC   Revised by [3]
RA   Dimopoulos G.;
RT   ;
RL   Submitted (07-MAR-1996) to the INSDC.
RL   George Dimopoulos, Insect Molecular Genetics Group, IMBB, Foundation for
RL   Research and Technology, Hellas,, Solonos 2, Heraklion, Crete, 71110,
RL   Greece
XX
RN   [3]
RP   1-414
RA   Dimopoulos G.;
RT   ;
RL   Submitted (13-OCT-1996) to the INSDC.
RL   George Dimopoulos, EMBL, Meyerhofstrasse 1, D-69117 Heidelberg, FRG
XX
RN   [5]
RX   DOI; 10.1073/pnas.93.23.13066.
RX   PUBMED; 8917545.
RA   Dimopoulos G.M., Richman A., della Torre A., Kafatos F.C., Louis C.;
RT   "Identification and characterization of differentially expressed cDNAs of
RT   the vector mosquito, Anopheles gambiae";
RL   Proc. Natl. Acad. Sci. U.S.A. 93(23):13066-13071(1996).
XX
DR   MD5; df8e3a4ccd85f7df7e3c44f456916ce0.
DR   EuropePMC; PMC24047; 8917545.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..414
FT                   /organism="Anopheles gambiae"
FT                   /chromosome="2, div 12B"
FT                   /strain="G3"
FT                   /mol_type="mRNA"
FT                   /sex="female"
FT                   /dev_stage="adult"
FT                   /clone="G14"
FT                   /tissue_type="midgut"
FT                   /db_xref="taxon:7165"
FT   CDS_pept        <1..405
FT                   /codon_start=1
FT                   /product="GTP-binding protein"
FT                   /db_xref="GOA:Q17031"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR003578"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037874"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q17031"
FT                   /protein_id="CAA93820.1"
FT                   /translation="SAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEIT
FT                   HHCQKTPFLLVGTQIDLRDENSTLEKLAKNKQKPITLEQGEKLAKELKAVKYVECSALT
FT                   QKGLKNVFDVAILAALEPPEPTKKRKCRFL"
FT   mRNA            <1..414
FT                   /note="isolated by differential display of cDNA from midgut
FT                   mRNA; not specifically expressed in midgut as shown by
FT                   Northern analysis"
FT                   /note="amplified by oligo-T primers from both ends; primer
FT                   sequences not included"
XX
SQ   Sequence 414 BP; 125 A; 96 C; 116 G; 77 T; 0 other;
     tcagctggcc aggaagatta cgatcgacta cgaccactgt cgtatccaca gaccgatgta        60
     tttttagtgt gcttttccgt cgtgagtccc agttcgttcg aaaacgttaa agaaaagtgg       120
     gtaccagaaa taacgcacca ttgccagaaa acgccgttcc tgctggtggg cacgcagatc       180
     gatctgcgcg acgaaaacag cacactggag aagctggcta agaacaaaca aaaacccatc       240
     accctcgagc agggtgagaa gctggcgaag gaactgaagg cggtgaagta tgtcgagtgt       300
     tcggcgttga cccagaaagg gctgaagaac gtgttcgacg tggcgatcct ggcggcgctg       360
     gaacccccag agccgacgaa aaagaggaag tgccgatttt tgtaaaaaaa aaaa             414
//

If you have problems or comments...

PBIL Back to PBIL home page