(data stored in ACNUC8465 zone)

EMBL: Z74207

ID   Z74207; SV 1; linear; genomic DNA; STD; FUN; 2301 BP.
XX
AC   Z74207; Z71256;
XX
DT   13-JUL-1996 (Rel. 48, Created)
DT   18-APR-2005 (Rel. 83, Last updated, Version 2)
XX
DE   S.cerevisiae chromosome IV reading frame ORF YDL159w
XX
KW   .
XX
OS   Saccharomyces cerevisiae (baker's yeast)
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Saccharomycetes;
OC   Saccharomycetales; Saccharomycetaceae; Saccharomyces.
XX
RN   [1]
RP   1-2301
RA   Pohl T.M.;
RT   ;
RL   Unpublished.
XX
RN   [2]
RP   759-2301
RA   Perea J., Blugeon C., Delaveau T., Jacq C.;
RT   ;
RL   Unpublished.
XX
RN   [3]
RP   1-2301
RA   MIPS;
RT   ;
RL   Submitted (09-JUL-1996) to the INSDC.
RL   Data collected by MIPS on behalf of the European yeast chromosome IV
RL   sequencing project. MIPS at the Max-Planck-Institut fuer Biochemie, Am
RL   Klopferspitz 18a D-82152 Martinsried, FRG; E-mail: Mewes@mips.embnet.org
XX
DR   MD5; 4b965ac1d7b065dd6da6bc169484b70a.
DR   Ensembl-Gn; YDL159C-B; saccharomyces_cerevisiae.
DR   Ensembl-Gn; YDL159W-A; saccharomyces_cerevisiae.
DR   Ensembl-Tr; YDL159C-B_mRNA; saccharomyces_cerevisiae.
DR   Ensembl-Tr; YDL159W-A_mRNA; saccharomyces_cerevisiae.
DR   GOA; Q3E774.
DR   GOA; Q8TGP9.
DR   UniProtKB/Swiss-Prot; Q3E774; YD159_YEAST.
DR   UniProtKB/Swiss-Prot; Q8TGP9; YD59B_YEAST.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2301
FT                   /organism="Saccharomyces cerevisiae"
FT                   /chromosome="IV"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:4932"
FT   CDS_pept        551..2098
FT                   /gene="STE7"
FT                   /note="ORF YDL159w"
FT                   /db_xref="GOA:P06784"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="SGD:S000002318"
FT                   /db_xref="UniProtKB/Swiss-Prot:P06784"
FT                   /protein_id="CAA98732.1"
FT                   /translation="MFQRKTLQRRNLKGLNLNLHPDVGNNGQLQEKTETHQGQSRIEGH
FT                   VMSNINAIQNNSNLFLRRGIKKKLTLDAFGDDQAISKPNTVVIQQPQNEPVLVLSSLSQ
FT                   SPCVSSSSSLSTPCIIDAYSNNFGLSPSSTNSTPSTIQGLSNIATPVENEHSISLPPLE
FT                   ESLSPAAADLKDTLSGTSNGNYIQLQDLVQLGKIGAGNSGTVVKALHVPDSKIVAKKTI
FT                   PVEQNNSTIINQLVRELSIVKNVKPHENIITFYGAYYNQHINNEIIILMEYSDCGSLDK
FT                   ILSVYKRFVQRGTVSSKKTWFNELTISKIAYGVLNGLDHLYRQYKIIHRDIKPSNVLIN
FT                   SKGQIKLCDFGVSKKLINSIADTFVGTSTYMSPERIQGNVYSIKGDVWSLGLMIIELVT
FT                   GEFPLGGHNDTPDGILDLLQRIVNEPSPRLPKDRIYSKEMTDFVNRCCIKNERERSSIH
FT                   ELLHHDLIMKYVSPSKDDKFRHWCRKIKSKIKEDKRIKREALDRAKLEKKQSERSTH"
FT   CDS_pept        complement(1936..2244)
FT                   /note="ORF YDL158c"
FT                   /db_xref="GOA:Q12047"
FT                   /db_xref="SGD:S000002317"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12047"
FT                   /protein_id="CAA98733.1"
FT                   /translation="MIIFKNIVTLENWFVIYIIRRVYIYMNIALRKGCEKKCNMFLTNV
FT                   IACIQWVDLSDCFFSNLARSKASLLILLSSFILDFIFLHQCLNLSSLDGDTYFIIRS"
XX
SQ   Sequence 2301 BP; 773 A; 403 C; 432 G; 693 T; 0 other;
     tactactatt ttctttcttg tcgtatttta ggcctgggat aagttattat gcgaatggcg        60
     atgcggttat gaagaaataa aagggctaaa agtaagaatt ttctgcgtct atctttctat       120
     taggaataaa atatgactat atttactatt attgttgttt tgtcgtacaa tcctttatga       180
     atgaaaatat taagcttgtg gtcttaaaag aatgtggatg aaacaaaact gaatccaatg       240
     atgagaaata aatgtacaat cagataataa acacttttat tgatgattgt cttttcttgc       300
     aaaccccaat gttacaatcg cccattagtt ctaagattgt gttgtccttt ttcttacgaa       360
     atttttttcc ctcccttttt tgatcactgt cctcgttata agtgattcgt ggggtaacgg       420
     cgatatcata ctattattgg cccatctgat ggattagaag acctacaggt taatgtgaag       480
     cgacactaat gataagaaaa ctgcatcgga tcatatctgt ttttgcagcg tggtatattg       540
     gttgttggtc atgtttcaac gaaagacttt acagagaagg aacttgaaag ggctcaatct       600
     taacctgcac ccagatgtgg gcaataatgg ccaattgcag gaaaagacag agactcacca       660
     gggacaatct cgaatagaag gccacgtgat gtctaacatt aatgcaatac agaataatag       720
     caacctgttt ttgcgaagag gcataaaaaa aaaactgacg ttggatgcgt ttggtgatga       780
     ccaagctata tcgaaaccaa acactgtggt aatacagcaa ccgcaaaatg aacctgtttt       840
     agttctgtct tctctatcac aatccccgtg tgtatcatca tcatcatctt tgtccacgcc       900
     atgcattata gatgcgtaca gtaataattt cggattatcg ccatcatcca cgaattctac       960
     tccctctacg attcagggat tgtccaatat tgcaacacca gttgaaaacg aacattcgat      1020
     atcactacca cctttggagg aaagcctatc gccagccgca gcagatctga aagatacgtt      1080
     gtcgggaact tcaaatggta attatataca actccaggac ttggttcagt tggggaaaat      1140
     tggtgctgga aattctggaa ctgtggtgaa ggcactacat gttcctgatt ccaaaatagt      1200
     tgccaaaaaa accattcctg tggaacagaa taacagtaca atcatcaacc aattagttag      1260
     ggaattatct atcgtcaaaa acgttaagcc ccatgaaaac attatcacct tctatggagc      1320
     ttattataac cagcatataa ataatgaaat cataatttta atggaatact ctgattgtgg      1380
     ttctttagat aaaatactgt ccgtttataa aaggtttgtt caaagaggga ctgtttcgag      1440
     taagaaaacc tggttcaacg aattaacaat atcaaaaata gcgtatggcg tactaaatgg      1500
     cttggatcat ttgtaccgac aatataagat cattcatcgt gatatcaagc cttccaatgt      1560
     tctgattaat agtaaggggc agattaagtt atgtgatttt ggagtttcca aaaaactaat      1620
     aaattctatc gctgatacat ttgttggaac gtccacttat atgtcaccag agaggataca      1680
     aggaaacgtt tattctatca aaggggacgt ttggtcattg ggcttaatga tcatcgagct      1740
     ggtaactgga gagtttcccc taggtgggca taacgataca cctgatggca tattggattt      1800
     gctgcaacgt attgtcaacg agccttcacc aagattaccc aaagaccgta tctattccaa      1860
     ggaaatgaca gattttgtca ataggtgttg tattaagaat gaaagggaaa ggtcatcgat      1920
     tcatgaattg ctacatcatg atcttataat gaaatacgta tcaccgtcta aagatgataa      1980
     atttagacat tggtgtagaa aaataaaatc taaaataaag gaagacaaga gaattaaaag      2040
     agaagccttg gaccgtgcca agttagaaaa gaaacaatcg gaaagatcaa cccattgaat      2100
     gcatgcgata acattagtta ggaacatatt gcactttttt tcacatccct ttctcaaagc      2160
     tatattcata tatatataga ctctcctgat tatgtaaatc acaaaccaat tttctaatgt      2220
     aacaatattt ttaaaaataa tcatcaaagt agcactttat gtacagaaaa tttcacgatt      2280
     gagagaagct tgcgaataat a                                                2301
//

If you have problems or comments...

PBIL Back to PBIL home page