(data stored in ACNUC15260 zone)

EMBL: Z79587

ID   Z79587; SV 1; linear; genomic DNA; STD; VRT; 972 BP.
XX
AC   Z79587;
XX
DT   16-MAY-1997 (Rel. 51, Created)
DT   27-JUN-2018 (Rel. 137, Last updated, Version 8)
XX
DE   G.gallus cor7b gene.
XX
KW   cor7 gene; G-protein coupled receptor.
XX
OS   Gallus gallus (chicken)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
OC   Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; Phasianidae;
OC   Phasianinae; Gallus.
XX
RN   [1]
RP   1-957
RA   Nef S, Allaman I, Fiumelli H, De Castro E, Nef P;
RT   "Olfaction in birds: differential embryonic expression of nine putative
RT   odorant receptor genes in the avian olfactory system";
RL   Mech. Dev. 55(1):65-77(1996).
XX
RN   [2]
RP   1-972
RA   Nef SSS, Nef PNN;
RT   "Olfaction: Transient expression of cor7b, a putative odorant receptor
RT   gene, in the notochord during early stages of development.";
RL   Proc. Natl. Acad. Sci. U.S.A. 94(9):4766-4771(1997).
XX
RN   [3]
RP   1-972
RA   Nef S;
RT   ;
RL   Submitted (19-AUG-1996) to the INSDC.
RL   to the INSDC. Serge Nef, of Biochemistry, University of Geneva, Sciences
RL   II, 30 quai Ernest Ansermet, Geneva, 1211 Geneve 4, Switzerland
XX
DR   MD5; 68f10e10840b253db77b8cb9e895b150.
DR   EuropePMC; PMC1087945; 15824306.
DR   EuropePMC; PMC20799; 9114066.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..972
FT                   /organism="Gallus gallus"
FT                   /mol_type="genomic DNA"
FT                   /clone_lib="lambda L47"
FT                   /clone="phage c24.2,"
FT                   /db_xref="taxon:9031"
FT   CDS_pept        1..972
FT                   /codon_start=1
FT                   /gene="cor7b"
FT                   /product="chick olfactory receptor 7"
FT                   /function="G-protein coupled receptor"
FT                   /db_xref="GOA:O13036"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="UniProtKB/TrEMBL:O13036"
FT                   /protein_id="CAB01848.1"
FT                   /translation="MEEKNSTQINIFLLQGFPGLMDLKVLLFIVLLLTYIVTVVENVLI
FT                   ISLIKANHELCKPMYFFLGQLSFIEVWYISVIVPKLLANFIAEDRSISFAGCMTQLYFF
FT                   SSFLCTECVLLSAMAYDRYVAICQPLRYLFIMTYQMCICLIALSWFTGFTVSLIKISFI
FT                   SQLEFCGSHVINHFFCDVSPVLNLACTDMSVAEMVDFVLALFILLVPLSITVVSYLLII
FT                   TTILHIPTTQSKKKAFSTCASHLTVVIIFFSATLFMYARPKKISSYDMNKLVSAVYTIV
FT                   TPMLNPFVYCLRNQELKRAFKKALSVKITISEVSRTIPSLQM"
XX
SQ   Sequence 972 BP; 230 A; 254 C; 173 G; 315 T; 0 other;
     atggaggaga agaattccac ccaaatcaac atctttctct tgcaaggatt cccaggcctt        60
     atggacttga aggtattgct cttcatagta ttgctgctga catacattgt aacggttgtg       120
     gagaatgtgc tcatcatttc cctgatcaaa gcaaaccatg aactctgcaa acccatgtat       180
     ttctttcttg gtcagctgtc tttcattgag gtctggtaca tctctgtcat tgtccccaaa       240
     ctcttggcaa atttcattgc agaagacagg agcatttcct ttgctggatg catgacccaa       300
     ctctatttct tcagttcttt cttatgcact gaatgtgtcc ttctctctgc catggcgtac       360
     gatcgctatg tggccatctg tcaaccactg cgctatctct tcatcatgac gtaccaaatg       420
     tgcatatgcc tgatagctct ctcctggttc actgggttca ctgtgtcctt gatcaagatt       480
     tccttcatct ctcagttgga gttctgtggt tcccatgtta ttaaccattt cttctgtgac       540
     gtcagcccag tgctaaacct tgcctgcact gatatgtcag tggcagagat ggtggacttt       600
     gtgttggcct tgttcatcct gctcgttccc ctctccatca cggttgtctc ctacctatta       660
     attatcacaa caatcctgca catccccacc acccaaagta agaagaaagc cttctctaca       720
     tgtgcttccc acttaactgt ggtcatcatt ttcttctcag ccactctctt catgtatgcg       780
     cggcccaaga aaatctcttc ttatgatatg aataaacttg tgtcagctgt gtatacaatt       840
     gtcacaccca tgttaaaccc tttcgtttac tgcctgagga atcaggaact gaagagagca       900
     tttaaaaaag ctctctcagt aaaaatcact atctctgaag tctccagaac cattccttct       960
     ctccaaatgt ga                                                           972
//

If you have problems or comments...

PBIL Back to PBIL home page