(data stored in ACNUC15468 zone)

EMBL: Z95127

ID   Z95127; SV 1; linear; genomic DNA; STD; MUS; 217 BP.
XX
AC   Z95127;
XX
DT   08-MAY-1997 (Rel. 51, Created)
DT   14-NOV-2006 (Rel. 89, Last updated, Version 7)
XX
DE   M.musculus Clc1 gene (exon 1) and joined mRNA
XX
KW   CLC1 gene; muscular chloride channel 1.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RX   DOI; 10.1007/s003359900553.
RX   PUBMED; 9321463.
RA   Schnuelle V., Antropova O., Gronemeier M., Wedemeyer N., Jockusch H.,
RA   Bartsch J.W.;
RT   "The mouse Clc1/myotonia gene: ETn insertion, a variable AATC repeat, and
RT   PCR diagnosis of alleles";
RL   Mamm. Genome 8(10):718-725(1997).
XX
RN   [2]
RP   1-217
RA   Bartsch J.W.;
RT   ;
RL   Submitted (07-MAY-1997) to the INSDC.
RL   Bartsch J.W., Developmental Biology Unit, W7, University of Bielefeld,
RL   D-33501 Bielefeld, FRG
XX
DR   MD5; bfc6feadb34d90440195f4dc17ef7477.
DR   Ensembl-Gn; ENSMUSG00000029862; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0030646; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0030619; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0030544; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0030629; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0030342; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0031083; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0029746; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0030318; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0030462; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0030418; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0030550; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0030452; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0031113; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0029458; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0029822; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000031894; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0077197; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0077278; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0077180; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0077218; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0076836; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0077686; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0077418; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0076799; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0076950; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0076845; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0076995; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0076847; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0077929; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0076842; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0075966; mus_musculus_wsbeij.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..217
FT                   /organism="Mus musculus"
FT                   /chromosome="6"
FT                   /strain="C 57/BL6"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   CDS_pept        join(28..207,Z95128.1:11..131,Z95129.1:11..141,
FT                   Z95130.1:11..140,Z95131.1:11..144,Z95132.1:11..88,
FT                   Z95133.1:11..89,Z95134.1:11..136,Z95135.1:11..95,
FT                   Z95136.1:11..112,Z95137.1:11..95,Z95138.1:11..160,
FT                   Z95139.1:11..80,Z95140.1:11..121,Z95141.1:11..224,
FT                   Z95142.1:11..144,Z95143.1:11..243,Z95144.1:11..149,
FT                   Z95145.1:11..90,Z95146.1:11..49,Z95147.1:11..115,
FT                   Z95148.1:11..97,Z95149.1:11..>379)
FT                   /gene="Clc1"
FT                   /product="muscular chloride channel 1"
FT                   /db_xref="GOA:Q64347"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR002243"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="MGI:MGI:88417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q64347"
FT                   /protein_id="CAB08359.1"
FT                   /translation="MERSQSQRHGGEQSWWGSAPQYQYMPFEHCTSYGLPSENGGLQHR
FT                   PRKDMGPRHNAHPTQIYGHHKEQYSYQAQDRGIPKKTDSSSTVDSLDEDHYSKCQDCVH
FT                   RLGRVLRRKLGEDWIFLVLLGLLMALVSWCMDYVSAKSLQAYKWTYAQMKPSLPLQYLA
FT                   WVTFPLILILFSALFCQLISPQAVGSGIPEMKTILRGVVLKEYLTLKAFVAKVVALTAG
FT                   LGSGIPVGKEGPFVHIASICTAVLSKFMSMFSGVYEQPYYYTDILTVGCAVGVGCCFGT
FT                   PLGGVLFSIEVTSTYFAVRNYWRGFFAATFSAFVFRVLAVWNKDAVTITALFRTNFRMD
FT                   FPFDLKELPAFAVIGICCGFLGAVFVYLHRQVMLGVRKHKCLSQFLAKHRLLYPGIVTF
FT                   VIASLTFPPGMGQFMAGELMPREAISTLFDNNTWVKHIGDPQSLGQSAVWLHPQVNVII
FT                   IILLFFVMKFWMSIVATTMPIPCGVNMPVFVLGAAFGRLVGEIMAMLFPEGILFDDIIY
FT                   KILPGGYAVIGAAALTGAVSHTVSTAVICFELTGQIAHILPMMVAVILANMVAQSLQPS
FT                   LYDSIIQVEKLPYLPDLGWNQLSKFTIFVEDIMVRDVKFVSASSTYGELRNLLQTTTVK
FT                   TLPLVDSKDSMILLGSVERSELQSLLQRHLCAERRLKAAQDMARKLSELPYNGKAQLAG
FT                   DWHPGGRPESFAFVDEDEDEDLSRKMELPLTPAPPPPSPPPPPSQFPIAPSNPEEPNGP
FT                   LPSHKQPPEASDSADQRSSTFQRLLHCLLGKAHSKKKKITQDSTDLVDNMSPEEIEAWE
FT                   REQLSQPVCFDCCCIDQSPFQLVEQTTLHKTHTLFSLLGLHLAYVTSMGKLTGVLALEE
FT                   LQKAIKGHTKSGVQLRPPLASFRNTTSIRKTPGGPPPPAESWNVPEGEDGAPEREVMVP
FT                   TMPETPVPPPSPEAPSCLAPARAEGELEELEMVGSLEPEEELADILHGPSLRSTDEEDE
FT                   DELIL"
FT   exon            <28..207
FT                   /gene="Clc1"
FT                   /product="muscular chloride channel 1"
FT                   /number=1
XX
SQ   Sequence 217 BP; 49 A; 66 C; 71 G; 31 T; 0 other;
     cctggctggg gcttgggggg agaacacatg gagcggtccc agtcccagcg gcatggaggg        60
     gaacagagct ggtggggcag tgccccccag taccagtaca tgccctttga acattgtacc       120
     agctacggac tgccctcaga gaatgggggc cttcagcacc ggccccgaaa ggacatgggt       180
     cccaggcaca atgcccaccc aacacaggtc atgggca                                217
//

If you have problems or comments...

PBIL Back to PBIL home page