(data stored in SCRATCH zone)

EMBL: Z98760

ID   Z98760; SV 1; linear; genomic DNA; STD; PLN; 5975 BP.
XX
AC   Z98760;
XX
DT   18-NOV-1997 (Rel. 53, Created)
DT   18-APR-2005 (Rel. 83, Last updated, Version 2)
XX
DE   Arabidopsis thaliana gene encoding arginyl-tRNA synthetase, clone G7
XX
KW   arginyl-tRNA synthetase.
XX
OS   Arabidopsis thaliana (thale cress)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae;
OC   rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis.
XX
RN   [2]
RP   1-5975
RA   Small I.D.;
RT   ;
RL   Submitted (22-AUG-1997) to the INSDC.
RL   Station de Genetique et Amelioration des Plantes, Institut National de la
RL   Recherche Agronomique, Route de St-Cyr, Versailles 78026 Cedex, France.
XX
RN   [3]
RP   1-5975
RA   Small I.D., Lancelin D.;
RT   "Duplicated arginyl-tRNA synthetase genes in Arabidopsis thaliana";
RL   Unpublished.
XX
DR   MD5; 29cb552df254f75acbf5444c0bda2778.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5975
FT                   /organism="Arabidopsis thaliana"
FT                   /mol_type="genomic DNA"
FT                   /clone_lib="Mulligan library, EEC-BRIDGE Arabidopsis Stock
FT                   Center, Cologne"
FT                   /clone="G7"
FT                   /db_xref="taxon:3702"
FT   mRNA            join(494..643,1394..1468,1555..1694,1792..1867,1946..2047,
FT                   2137..2352,2460..2540,2670..2753,2867..2971,3072..3250,
FT                   3421..3505,3609..3795,3901..3970,4153..4222,4304..4393,
FT                   4779..4847,4942..5040,5154..5491)
FT                   /product="arginyl-tRNA synthetase"
FT                   /note="long mRNA possibly encodes protein with N-terminal
FT                   extension"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   CDS_pept        join(554..643,1394..1468,1555..1694,1792..1867,1946..2047,
FT                   2137..2352,2460..2540,2670..2753,2867..2971,3072..3250,
FT                   3421..3505,3609..3795,3901..3970,4153..4222,4304..4393,
FT                   4779..4847,4942..5040,5154..5264)
FT                   /codon_start=1
FT                   /product="arginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.19"
FT                   /note="The ATG at 554 is in a poor context. Major
FT                   translation start may be at 1460; arginine-tRNA ligase"
FT                   /db_xref="GOA:O23247"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/Swiss-Prot:O23247"
FT                   /protein_id="CAB11468.1"
FT                   /translation="MFIFPKDENRRETLTTKLRFSADHLTFTTVTEKLRATAWRFAFSS
FT                   RAKSVVAMAANEEFTGNLKRQLAKLFDVSLKLTVPDEPSVEPLVAASALGKFGDYQCNN
FT                   AMGLWSIIKGKGTQFKGPPAVGQALVKSLPTSEMVESCSVAGPGFINVVLSAKWMAKSI
FT                   ENMLIDGVDTWAPTLSVKRAVVDFSSPNIAKEMHVGHLRSTIIGDTLARMLEYSHVEVL
FT                   RRNHVGDWGTQFGMLIEYLFEKFPDTDSVTETAIGDLQVFYKASKHKFDLDEAFKEKAQ
FT                   QAVVRLQGGDPVYRKAWAKICDISRTEFAKVYQRLRVELEEKGESFYNPHIAKVIEELN
FT                   SKGLVEESEGARVIFLEGFDIPLMVVKSDGGFNYASTDLTALWYRLNEEKAEWIIYVTD
FT                   VGQQQHFNMFFKAARKAGWLPDNDKTYPRVNHVGFGLVLGEDGKRFRTRATDVVRLVDL
FT                   LDEAKTRSKLALIERGKDKEWTPEELDQTAEAVGYGAVKYADLKNNRLTNYTFSFDQML
FT                   NDKGNTAVYLLYAHARICSIIRKSGKDIDELKKTGKLALDHADERALGLHLLRFAETVE
FT                   EACTNLLPSVLCEYLYNLSEHFTRFYSNCQVNGSPEETSRLLLCEATAIVMRKCFHLLG
FT                   ITPVYKI"
FT   mRNA            join(895..1016,1394..1468,1555..1694,1792..1867,1946..2047,
FT                   2137..2352,2460..2540,2670..2753,2867..2971,3072..3250,
FT                   3421..3505,3609..3795,3901..3970,4153..4222,4304..4393,
FT                   4779..4847,4942..5040,5154..5491)
FT                   /product="arginyl-tRNA synthetase"
FT                   /note="short mRNA produced by alternative transcription
FT                   start and alternative splicing"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   CDS_pept        join(1460..1468,1555..1694,1792..1867,1946..2047,
FT                   2137..2352,2460..2540,2670..2753,2867..2971,3072..3250,
FT                   3421..3505,3609..3795,3901..3970,4153..4222,4304..4393,
FT                   4779..4847,4942..5040,5154..5264)
FT                   /codon_start=1
FT                   /product="arginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.19"
FT                   /note="arginine-tRNA ligase"
FT                   /db_xref="GOA:Q7DLG4"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/TrEMBL:Q7DLG4"
FT                   /protein_id="CAB11469.1"
FT                   /translation="MAANEEFTGNLKRQLAKLFDVSLKLTVPDEPSVEPLVAASALGKF
FT                   GDYQCNNAMGLWSIIKGKGTQFKGPPAVGQALVKSLPTSEMVESCSVAGPGFINVVLSA
FT                   KWMAKSIENMLIDGVDTWAPTLSVKRAVVDFSSPNIAKEMHVGHLRSTIIGDTLARMLE
FT                   YSHVEVLRRNHVGDWGTQFGMLIEYLFEKFPDTDSVTETAIGDLQVFYKASKHKFDLDE
FT                   AFKEKAQQAVVRLQGGDPVYRKAWAKICDISRTEFAKVYQRLRVELEEKGESFYNPHIA
FT                   KVIEELNSKGLVEESEGARVIFLEGFDIPLMVVKSDGGFNYASTDLTALWYRLNEEKAE
FT                   WIIYVTDVGQQQHFNMFFKAARKAGWLPDNDKTYPRVNHVGFGLVLGEDGKRFRTRATD
FT                   VVRLVDLLDEAKTRSKLALIERGKDKEWTPEELDQTAEAVGYGAVKYADLKNNRLTNYT
FT                   FSFDQMLNDKGNTAVYLLYAHARICSIIRKSGKDIDELKKTGKLALDHADERALGLHLL
FT                   RFAETVEEACTNLLPSVLCEYLYNLSEHFTRFYSNCQVNGSPEETSRLLLCEATAIVMR
FT                   KCFHLLGITPVYKI"
XX
SQ   Sequence 5975 BP; 1694 A; 1092 C; 1176 G; 2013 T; 0 other;
     gagctcaccc aactttgctg agcttcttga ggcatgaaag cttcaacatg gaaagcaagg        60
     actttcctat atattctcgc ttatccagac gattttgagt catccagagg gaaaaaggta       120
     gatcaactga tattagaaga cgatgctcaa atttacatta gaaactccat ccttgagtca       180
     gtgatgagtt tttcctcatc tcctcttgct gatgatgaaa gtaaaggtct aatccttcag       240
     gtgctacttt cttaccttaa tgtcacttgg tgtttatctt gcatctatat gcagttgcct       300
     cttcagtatc aataatataa gcttgattct gagagtatat ttgcttcatc tgttcagacg       360
     aaaaccagat tctgaatagc caatttgacg taaaccgcgc tttagttggt ctatccgaat       420
     agtccagccc ggtttaatta agtttgcagg ttcgggtcga tcaaaatgtc tattaccccg       480
     gtggttaaga gacatattca acgaattaac aaggaaataa ataatcaaaa gaacccttaa       540
     aattcatcat catatgttca ttttcccaaa agacgaaaac agaagagaaa ctttaacgac       600
     aaagctccgt ttctccgccg atcatctgac ttttaccacc gtggtatgat tctccatccc       660
     ttcttattta tttaatcttc ctcaaattcg ccgttgattt gttcaacttt agcctaaatg       720
     ttcaacgaat cggatcgcat taataaacac agtaacctaa tggcataatg ggcctaatat       780
     tttttcggcc caacacgaaa attacctgaa caattaaaaa aaaaaaagaa gataaaataa       840
     aaaaataaaa aaagggaaac aaattaaaga gagagacaga aaattggaaa tggcaataat       900
     aagcctaacc ctctttccgg tcacagcaac accaccgccg tcttgtctct tctccttgaa       960
     tcgtttttct cgttcccatc atcactttgc ttatttctct tcttcttctc caactggtaa      1020
     aatcctctct ccgagctctt cttatctcca tttttctctc tacttgtggt ttatctctgc      1080
     tcgactacat tctccccatt tgttgagatt agattcttat tcttggctaa gctcattttt      1140
     tttctaactg ttggaacttt gcgaaatgat attgtgtttg cgtggttttc gttttagttt      1200
     ctatagaaat gctgaagagg gtaagtgttc atttttgttt atatttcaac acggtttgtg      1260
     tgcactgtat caatgatttg atgtaactcc aataaagaag agcaatctac tgcttacaat      1320
     caaagtttca ttgtttgttt tttttaattg caatttggat gtactgattt cgctttgggg      1380
     ttttgtaacc tagacagaaa aattgagagc aacggcttgg agatttgctt tctcatccag      1440
     agctaagtcc gtggtagcaa tggcagctgt aagtcagcag ttttttttta aaatccagga      1500
     gaaagtttat aacattctta tttccctgtt tcatgactaa tttctttttg acagaatgaa      1560
     gaatttacgg gaaatctgaa acgtcaactc gcgaagctct ttgatgtttc tctaaaatta      1620
     acggttcctg atgaacctag tgttgagccc ttggtggctg cctccgctct tggaaaattt      1680
     ggagattacc aatggtgctc cccctctcac ttggttcagt gaaattatag ttctaattaa      1740
     gttgttttct ctttgtcaaa ttatattctt acatcatatt gttgtctgca gtaacaacgc      1800
     aatgggacta tggtccataa ttaaaggaaa gggtactcag ttcaagggtc ctccagctgt      1860
     tggacaggtt cgtttgtttg gtctttataa tttcgtggct tttggtatgt tctttaactt      1920
     ttattctgat ccttttttca cataggccct tgttaagagt ctccctactt ctgagatggt      1980
     agaatcatgc tctgtagctg gacctggctt tattaatgtt gtactatcag ctaagtggat      2040
     ggctaaggtg ctcctgttgt aattgtgtag tccttttcta gtgctcatgt aaataaaatg      2100
     tgtgtttagc ataattgttt tttaatctat ttgcagagta ttgaaaatat gctcatcgat      2160
     ggagttgaca catgggcacc tactctttcg gttaagagag ctgtagttga tttttcctct      2220
     cccaacattg caaaagaaat gcatgttggt catctaagat caactatcat tggtgacact      2280
     ctagctcgca tgctcgagta ctcacatgtt gaagttctac gcagaaacca tgttggtgac      2340
     tggggaacac aggtagctac ttttctgctc ttcaaatggt tttttgacct tggttctttt      2400
     tttgtaattg ttgtgttcca atatttatca gcgaaataaa agctgctttt attctgcagt      2460
     ttggcatgct aattgagtac ctctttgaga aatttcctga tacagatagt gtgaccgaga      2520
     cagcaattgg agatcttcag gtcagctgcc ttctataata tgccctctca agctttacag      2580
     ttttattatg tagcaatatt ggcataatat gcttgcatgt gaagaaccaa agcaatatag      2640
     tttctaacct tagagatgtc gtttgatagg tgttttacaa ggcatcaaaa cataaatttg      2700
     atctggacga ggcctttaag gaaaaagcac aacaggctgt ggtccgtcta caggtaaata      2760
     atcactagtg tgttattctg ttttgcagtg tctcaatttg cagctgcctt tggttgcaag      2820
     atctaaatta ctcacaagtc ttaatatatt cctttctatg gcgcagggtg gtgatcctgt      2880
     ttaccgtaag gcttgggcta agatctgtga catcagccga actgagtttg ccaaggttta      2940
     ccaacgcctt cgagttgagc ttgaagaaaa ggtaaagtaa tagctggacc tgtacaacat      3000
     tatttgagat ataatggaaa aagagataca tggatgggta atgaaaaatg cattgattta      3060
     attcatgaca gggagaaagc ttttacaacc ctcatattgc taaagtaatt gaggaattga      3120
     atagcaaggg gttggttgaa gaaagtgaag gtgctcgtgt gattttcctt gaaggcttcg      3180
     acatcccact catggttgta aagagtgatg gtggttttaa ctatgcctca acagatctga      3240
     ctgctctttg gtgggttatc tttacgttag ttatttcatg aaatccggat tttagtagtg      3300
     atcttttgaa aatagatctc acatgttatg actttccgtg tctgtactta ctgaagtttg      3360
     atctgaactt gcatattgtt caatggattg tctgctggtg ctaaattttg cctggcccag      3420
     gtaccggctc aatgaagaga aagctgagtg gatcatatat gtgaccgatg ttggccagca      3480
     gcagcacttt aatatgttct tcaaagtagg tttgatgaat attttattgt ttttgacgtc      3540
     ttgtgaaata ttttctattg actgaaactg tcagtcgtaa ctgtggttat catgttactg      3600
     tgaattaggc tgccagaaaa gcaggttggc ttccagacaa tgataaaact taccctagag      3660
     ttaaccatgt tggttttggt ctcgtccttg gggaagatgg caagcgattt agaactcggg      3720
     caacagatgt agtccgccta gttgatttgc tagatgaggc caagactcgc agtaaacttg      3780
     cccttattga gcgcggtatc taactttgtc ttaaaactct ctacgttttg aaatgttgaa      3840
     ccatcacttg ttgagttatt atttggtcta ttaatcctta catgtttttt ctctgtttag      3900
     gtaaggacaa agaatggaca ccggaagaac tggaccaaac agctgaggca gttggatatg      3960
     gtgcggtcaa gtaagtatca tctctattct actgctgata atagtgaatt ctattcagta      4020
     tcttccggtt ttcggtgacg ttttataatt aaggctgctc aattatgatg aatgatttgc      4080
     cagatgtttt gacagttggt ttatattcat ggctacaagc taatgtgcgg ttttgtttaa      4140
     tattctttca aggtatgctg acctgaagaa caacagatta acaaattata ctttcagctt      4200
     tgatcaaatg cttaatgaca aggtactgaa atttgccacc tagtttacaa atttgcattt      4260
     tgcagtcacc tacacaacct tattgatcat atgtcatgag cagggaaata cagccgttta      4320
     ccttctttac gcccatgctc ggatctgttc aatcatcaga aagtctggca aagacataga      4380
     tgagctgaaa aaggtacttt agctgcatga acatgaatcg ctgaatttta ttctttgttc      4440
     ctcttggctg cccctgaaac tttcccattg tctctatcaa ggaaatgcga cgttataaac      4500
     tatttagttt gaaattgaaa gcttaaacaa ttttcagaag tgtttaaact tttaagttaa      4560
     tgccagtgtc tatagtgagc atttaatttt ttggagtctc aagattcatt ttgtatacac      4620
     cctgggcctt tttgtccttt ttagtttctt ggttgtgcta tctttcacat tttcataaga      4680
     tatggatcgt cgaacaccta cgaagtctgt tattagttcc taccatacgc agtacaataa      4740
     agagtaattc ttatgtttca acatcttatt cattgcagac aggaaaatta gcattggatc      4800
     atgcagatga acgagcactg gggcttcact tgcttcgatt tgctgaggta acacatgctc      4860
     tctttagata cttctttcat atttggcttc tttttctcgg caacaagatg aacttgaaac      4920
     tcatgtgtga acaatttgca gacggtggag gaagcttgta ccaacttatt accgagtgtt      4980
     ctgtgcgagt acctctacaa tttatctgaa cactttacca gattctactc caattgtcag      5040
     gtgtgcaatt cacaagactc tacatttctc atttgatatt gtgatattag actgcatagc      5100
     tgcataatca accactataa tgttgatctc acttaaaaca tgatctttta caggtcaatg      5160
     gttcaccaga ggagacaagc cgtctcctac tttgtgaagc aacggccata gtcatgcgga      5220
     aatgcttcca ccttcttgga atcactccgg tttacaagat ttgatcacat cacaagtaaa      5280
     cgacccaaag gaaaatgttt ttaattcgtt ttgacaattt ttctgcacaa ttagtgtaaa      5340
     aggcgttatt tggccctaaa ttctctctgt tctcatttag cttggggcaa acttgtatac      5400
     aaatgaatac aatgttaaac tgaacccaga aggttgtttt gtcatgtcat tgaactgatt      5460
     tgggtgaatc atgaaatggt ttaaaggtta atcttgaatt tgaatgtttt gaggatgttc      5520
     tcgtggcttt catggagatt gttgcctttg gtccatagaa ataatccctt ttgcagcatg      5580
     acttcgttct tgatcctctc ttcacaagat cctgtagact tgtgacattt gctagagatg      5640
     tgaatgattg agatttgcct ttataatact ttgaaagtcc tcctttcttg acctgactgt      5700
     aagaaaaaaa acaaagacaa taagaaaaca aattcttaac actgtctatg gagacaagat      5760
     ggaacgatca aagagaataa ggactgtgag ataatatttc acccagagat ttagtgtcat      5820
     tacatgatag ggagctgaga gatgaggtcc gaaagatcgt cgaaaggccc atttgaagaa      5880
     gaagaagaag aagaagaaga agaagaagca tcctctgtta aatcagatga acacatagag      5940
     atagaagatg aagatgaaac ttttgcagag gatcc                                 5975
//

If you have problems or comments...

PBIL Back to PBIL home page