(data stored in ACNUC7421 zone)

EMBL: AB001488.DINB

AB001488.DINB        Location/Qualifiers
FT   CDS_pept        complement(141465..141983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dinB"
FT                   /note="DNA DAMAGE-INDUCIBLE DINB PROTEIN, SIMILAR PRODUCT
FT                   IN SYNECHOCYSTIS."
FT                   /db_xref="GOA:Q02886"
FT                   /db_xref="InterPro:IPR007837"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q02886"
FT                   /protein_id="BAA19396.1"
FT                   /translation="MSDFAFKLYEYNVWANQQIFNRLKELPKEIYHQEIQSVFPSISHV
FT                   LSHVYLSDLGWIEVFSGKTLSDALALAEQLKEQTEAKEIEEMEDLFLRLSERYILFLQQ
FT                   KEQLNKPLQIQNPSSGIMKTTVSELLPHVVNHGTYHRGNITAMLRQAGYASAPTDYGLY
FT                   LFMTKTEKA"
     atgtcagatt ttgcattcaa attgtatgaa tataacgtct gggccaatca acaaatattc        60
     aaccgattaa aagagcttcc aaaagagata taccatcaag aaattcaaag cgtgtttccg       120
     tcaatatccc atgtattgtc tcatgtttat ctttctgatc tcggctggat tgaagtgttt       180
     tccggcaaaa ccttgagcga tgcgttggct ttagctgaac agcttaaaga acagacagag       240
     gctaaagaaa tagaggaaat ggaagacctt tttctgaggt tatccgagcg ctatatacta       300
     tttttacagc aaaaagaaca gctcaataag ccactccaga ttcaaaatcc ctcaagcgga       360
     atcatgaaaa caactgtttc cgaactgctt ccccacgttg tcaatcacgg gacataccac       420
     cgcggcaata tcacagcaat gctgcggcag gcaggctacg catccgcacc gacagattac       480
     gggctctacc tgtttatgac aaaaactgaa aaagcataa                              519
//

If you have problems or comments...

PBIL Back to PBIL home page