(data stored in ACNUC7421 zone)

EMBL: AB001488.EXPZ

AB001488.EXPZ        Location/Qualifiers
FT   CDS_pept        complement(137954..139597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="expZ"
FT                   /product="PROBABLE ATP-BINDING TRANSPORT PROTEIN"
FT                   /db_xref="GOA:P39115"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="PDB:6HA8"
FT                   /db_xref="UniProtKB/Swiss-Prot:P39115"
FT                   /protein_id="BAA19394.1"
FT                   /translation="MKEIVTLTNVSYEVKDQTVFKHVNASVQQGDIIGIIGKNGAGKST
FT                   LLHLIHNDLAPAQGQILRKDIKLALVEQETAAYSFADQTPAEKKLLEKWHVPLRDFHQL
FT                   SGGEKLKARLAKGLSEDADLLLLDEPTNHLDEKSLQFLIQQLKHYNGTVILVSHDRYFL
FT                   DEAATKIWSLEDQTLIEFKGNYSGYMKFREKKRLTQQREYEKQQKMVERIEAQMNGLAS
FT                   WSEKAHAQSTKKEGFKEYHRVKAKRTDAQIKSKQKRLEKELEKAKAEPVTPEYTVRFSI
FT                   DTTHKTGKRFLEVQNVTKAFGERTLFKNANFTIQHGEKVAIIGPNGSGKTTLLNIILGQ
FT                   ETAEGSVWVSPSANIGYLTQEVFDLPLEQTPEELFENETFKARGHVQNLMRHLGFTAAQ
FT                   WTEPIKHMSMGERVKIKLMAYILEEKDVLILDEPTNHLDLPSREQLEETLSQYSGTLLA
FT                   VSHDRYFLEKTTNSKLVISNNGIEKQLNDVPSERNEREELRLKLETERQEVLGKLSFMT
FT                   PNDKGYKELDQAFNELTKRIKELDHQDKKD"
     atgaaagaga tcgtaacatt aacaaacgtt agctatgaag taaaggatca aactgttttt        60
     aaacatgtaa acgccagtgt tcagcaagga gatatcattg ggattatcgg caaaaacggc       120
     gctgggaaat ctacgttgct gcacctcatt cacaatgact tagcccctgc acagggtcaa       180
     atccttcgga aggatataaa actggctttg gttgaacagg aaaccgcggc gtattccttt       240
     gcggatcaga cacctgccga aaagaagtta ctggagaaat ggcatgtgcc tcttcgtgat       300
     tttcatcagt taagcggcgg tgaaaaactg aaagcgcggc tggcgaaagg actatcagag       360
     gatgcagatc tgctgctgtt agatgaaccg acaaaccacc ttgatgaaaa aagcttgcaa       420
     tttctcatcc aacagctgaa acattataac ggcactgtga ttctcgtttc tcacgatcga       480
     tattttttag acgaagccgc aacaaaaata tggtcgcttg aggatcagac gctgattgaa       540
     ttcaaaggga attactccgg gtatatgaag ttccgggaga agaaaagact cacccagcag       600
     cgtgaatatg aaaagcagca aaaaatggtt gaacggattg aagcacaaat gaatgggctc       660
     gcttcttggt cggaaaaagc ccatgctcaa tcgacgaaaa aggaagggtt taaagaatat       720
     caccgggtaa aagcgaagcg tacggatgcc cagataaaat ccaagcagaa gcggcttgaa       780
     aaagagcttg aaaaagcaaa ggcggaaccc gttaccccag aatatacagt ccgcttttca       840
     atcgatacaa cccacaaaac aggaaaacgt tttttagaag ttcagaatgt aacaaaagcg       900
     tttggagaaa ggactctctt taaaaacgca aactttacaa ttcagcacgg cgaaaaggtt       960
     gcgatcatag gccccaatgg cagcggaaaa acgacattac tgaacatcat tctgggacag      1020
     gaaacagcag aaggaagtgt atgggtgtcg ccgtccgcaa acatcggcta tttaacgcag      1080
     gaggtgtttg atttgccttt agaacaaaca ccggaagagt tatttgagaa tgaaacattc      1140
     aaagcaaggg ggcacgttca aaatctgatg aggcacttag gttttacagc cgcccaatgg      1200
     actgaaccga tcaagcatat gagtatgggt gagcgtgtaa agatcaagct gatggcatat      1260
     attctggagg aaaaagacgt gctgatttta gatgagccga caaaccatct cgacctgccg      1320
     tcacgcgaac agctggaaga aacactgtca caatacagcg gcacattgct ggcggtttca      1380
     catgaccgat actttctcga aaaaacaaca aacagtaaac tcgtcatctc aaacaacggc      1440
     atcgaaaagc agttaaacga cgttccttca gaaagaaatg agcgggagga gcttcggtta      1500
     aagcttgaga cagaaagaca agaagtgctg ggaaagctca gttttatgac gccaaatgat      1560
     aaagggtata aggagcttga tcaggctttc aatgagctta cgaaacgaat aaaagagctg      1620
     gatcatcaag acaaaaaaga ctga                                             1644
//

If you have problems or comments...

PBIL Back to PBIL home page