(data stored in ACNUC7421 zone)

EMBL: AB001488.GSIB

AB001488.GSIB        Location/Qualifiers
FT   CDS_pept        27563..27934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gsiB"
FT                   /product="GLUCOSE STARVATION-INDUCIBLE PROTEIN B (GENERAL
FT                   STRESS PROTEIN B)"
FT                   /db_xref="InterPro:IPR019626"
FT                   /db_xref="UniProtKB/Swiss-Prot:P26907"
FT                   /protein_id="BAA19277.1"
FT                   /translation="MADNNKMSREEAGRKGGETTSKNHDKEFYQEIGQKGGEATSKNHD
FT                   KEFYQEIGEKGGEATSKNHDKEFYQEIGEKGGEATSENHDKEFYQEIGRKGGEATSKNH
FT                   DKEFYQEIGSKGGNARNND"
     atggcagaca ataacaaaat gagcagagaa gaagcaggta gaaaaggcgg agaaacaaca        60
     agcaagaacc atgacaaaga attctatcaa gagattggtc aaaaaggcgg agaagccact       120
     agcaaaaacc atgacaaaga attctatcag gaaatcggcg aaaaaggcgg agaagccact       180
     agcaagaacc atgacaaaga gttctatcaa gaaatcggtg aaaaaggcgg agaagccact       240
     agcgaaaatc atgacaaaga attctatcaa gaaatcggcc gaaaaggcgg agaggcaaca       300
     agcaaaaatc atgataaaga attctaccaa gaaattggct caaaaggcgg aaacgcccgc       360
     aacaacgact aa                                                           372
//

If you have problems or comments...

PBIL Back to PBIL home page