(data stored in ACNUC7421 zone)

EMBL: AB001488.RSBU

AB001488.RSBU        Location/Qualifiers
FT   CDS_pept        54082..55089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsbU"
FT                   /product="SIGMA FACTOR SIGB REGULATION PROTEIN RSBU"
FT                   /note="SIMILAR PRODUCT IN SYNECHOCYSTIS."
FT                   /db_xref="GOA:P40399"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR014787"
FT                   /db_xref="InterPro:IPR017944"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="PDB:1W53"
FT                   /db_xref="PDB:2J6Y"
FT                   /db_xref="PDB:2J6Z"
FT                   /db_xref="PDB:2J70"
FT                   /db_xref="UniProtKB/Swiss-Prot:P40399"
FT                   /protein_id="BAA19307.1"
FT                   /translation="MDFREVIEQRYHQLLSRYIAELTETSLYQAQKFSRKTIEHQIPPE
FT                   EIISIHRKVLKELYPSLPEDVFHSLDFLIEVMIGYGMAYQEHQTLRGIQQEIKSEIEIA
FT                   ANVQQTLLGTKVPQEEALDIGAISVPAKQMSGDYYHFVKDKESINIAIADVIGKGIPAA
FT                   LCMSMIKYAMDSLPETGIHPSQVLKNLNRVVEQNVDASMFITMFYANYNMDKHQFTYAS
FT                   AGHEPGFYYSQKDNTFYDLEAKGLVLGISQDYDYKQFDQHLEKGDMIVLFSDGVTECRT
FT                   ENGFLERPDLQKLIEEHMCSSAQEMVKNIYDSLLKLQDFQLHDDFTLIVLRRKV"
     gtggatttta gggaggttat tgagcagcgg tatcatcagc tgcttagtcg atatatagcc        60
     gaattaacag aaacatcttt atatcaagcc caaaaattca gccgaaaaac aatcgagcac       120
     caaattcctc cggaagaaat catcagcatt cacagaaaag tgctgaagga gctgtatcca       180
     agtctcccgg aagatgtgtt tcattcgctg gattttttaa tagaagtcat gattggctat       240
     ggaatggctt atcaggagca tcaaaccctt agagggatac agcaggaaat caaatcagaa       300
     attgaaatcg cggcaaatgt ccagcagacg cttctcggaa ctaaagttcc tcaggaggaa       360
     gcgctggata tcggcgccat cagtgttccc gctaaacaga tgagcggtga ttactaccac       420
     tttgtcaaag acaaggaatc catcaatatc gcaatcgcgg acgtgatcgg aaaaggcatt       480
     ccagcggctt tatgcatgtc catgattaaa tacgcaatgg actctttgcc ggaaacgggc       540
     atacaccctt ctcaagtgct gaaaaatttg aatcgtgttg ttgaacaaaa cgttgatgcc       600
     agtatgttta ttacgatgtt ttatgcgaat tacaatatgg acaagcatca atttacatat       660
     gcttcagcgg gacatgaacc gggattctat tattctcaaa aagacaacac gttttacgat       720
     ttagaggcca aaggactcgt tctcggcatc tcgcaggact atgactacaa acaattcgat       780
     cagcatctgg aaaagggcga tatgattgtt ttattttctg acggcgtcac agaatgcaga       840
     acggaaaacg gtttcttgga gcgtcctgat ctgcagaagc tcattgagga acatatgtgt       900
     tcctctgcgc aggaaatggt caaaaacatt tatgacagcc tcctcaaatt gcaggatttt       960
     cagcttcacg atgattttac gttaattgtt ttgcggagaa aggtttaa                   1008
//

If you have problems or comments...

PBIL Back to PBIL home page