(data stored in ACNUC7421 zone)

EMBL: AB001488.YDBF

AB001488.YDBF        Location/Qualifiers
FT   CDS_pept        30831..32438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydbF"
FT                   /note="PROBABLE SENSORY TRANSDUCTION HISTIDINE KINASE."
FT                   /db_xref="GOA:P96601"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR016120"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033463"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR039506"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96601"
FT                   /protein_id="BAA19282.1"
FT                   /translation="MNKKKLSIRWKITILSYILVIFSFLIGGIVLIGNIQHTEERELKK
FT                   RLMNTARTVSEMTEVKEALARKKQTEAVRHAVEEIRMINEADYIVVMDMNHIRYTHPVS
FT                   TSIGKKSEGADEEAAFAEHIYFSEAKGEIGTAVRAFYPVKDQDLNQIGVVLVGKTLPGI
FT                   ADILLHLKRDIAFIVVLTLGFGLAGSFLLARHIKKQMFQLEPHEIVRMYEERTATFHSM
FT                   NEGVIAIDNRLVITIFNEKAKQIFEVQGDLIGKVIWEVLKDSRLPEIVERNKAVYNEEI
FT                   RVSGKVIMSSRIPIVMKKKVIGAVAIFQDRTEAAKMAEELTGVRNFVEALRVQNHEHMN
FT                   KLHTIAGLIQLGKSEKALQLAFQASTEQENVTEFLHRSIQNDAAAGLLLSKIRRGRELG
FT                   IAVHIDENSSLQQFPEHVDQHDIVVLLGNLIENAFGSFETVQSEDKRIDISIEQTDDIL
FT                   AILIEDNGCGIEPTHMPRLYDKGFTVNKTGGTGYGLYLVKQIIDKGSGTIEVDSHAGQG
FT                   TSFSIVFPMKGEEAQHGS"
     atgaacaaaa agaagctctc aatccgttgg aaaatcacga tcttatccta tatactcgtc        60
     attttctcct ttttgatcgg cggcattgtg ctcatcggca acattcagca tacagaggag       120
     cgggagctga aaaagcggct gatgaatacg gcccggacgg tgtcagagat gacagaagtg       180
     aaagaagcct tggcgcgaaa aaaacaaaca gaagcggttc gccatgcggt tgaagaaatc       240
     aggatgatta atgaagcaga ctatattgtc gtcatggata tgaatcacat ccgatatacg       300
     catcctgtca gcacaagcat tggcaagaaa tcagaaggtg cagacgagga ggcagctttt       360
     gcggagcaca tttatttctc tgaagcaaag ggcgagatcg gcacggcggt tcgcgctttt       420
     tatccggtaa aggatcaaga cctgaaccaa ataggcgtgg tgcttgtcgg aaaaacgctg       480
     ccggggatcg ctgacatcct gcttcattta aagcgtgata tcgccttcat cgttgtgctg       540
     acactcggct ttggccttgc tggttccttt ttgctggccc gccatatcaa aaaacaaatg       600
     tttcagcttg aaccccatga gattgtccga atgtatgaag aacggacagc gacgtttcac       660
     tcgatgaatg aaggggtgat cgctattgac aatcgtctcg tcattacgat cttcaatgaa       720
     aaagcgaaac agatctttga agtgcagggg gatctaatcg gcaaggtgat ttgggaggtt       780
     ctcaaggatt cgcgcctgcc cgaaatcgtg gagcggaaca aagcggttta taatgaagaa       840
     attcgtgtca gcggtaaggt gatcatgagc agcagaattc cgatcgtcat gaagaaaaaa       900
     gtgatcggcg ccgttgcgat ttttcaggac agaacggaag cggccaagat ggcagaggaa       960
     ttgactggtg tcagaaactt tgtggaggcg ctccgtgtcc aaaaccatga gcatatgaat      1020
     aagctgcaca cgatcgccgg tctcatccag ctggggaaat ctgaaaaagc cttgcagctt      1080
     gcattccagg cgtcaactga gcaggaaaat gtgactgaat ttctgcaccg ctcgattcaa      1140
     aatgacgctg cggcaggcct tctattaagt aaaatcagaa ggggaagaga gctcggcatt      1200
     gctgttcata tagatgaaaa cagcagtctt cagcaatttc ccgagcatgt tgatcagcat      1260
     gatattgtcg tgcttttggg gaatctgatt gaaaatgcct tcggctcatt tgaaaccgtt      1320
     caatctgaag acaaacgaat tgacattagt atcgaacaaa cagatgatat ccttgctatt      1380
     ttaatagaag ataacggctg cggaattgaa ccgacacata tgcctcgcct ttatgacaaa      1440
     ggttttacgg tcaataaaac tggcggcaca ggctatggcc tgtatctagt gaaacaaatc      1500
     atagacaaag gatcgggcac gatagaagtt gattcacatg cggggcaggg gacatctttt      1560
     tctatcgttt ttccaatgaa gggggaggaa gcacagcatg gctcgtaa                   1608
//

If you have problems or comments...

PBIL Back to PBIL home page