(data stored in ACNUC7421 zone)

EMBL: AB001488.YDBH

AB001488.YDBH        Location/Qualifiers
FT   CDS_pept        33229..34494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydbH"
FT                   /note="PROBABLE C4-DICARBOXYLATE TRANSPORT PROTEIN."
FT                   /db_xref="GOA:P96603"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR018107"
FT                   /db_xref="InterPro:IPR023954"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96603"
FT                   /protein_id="BAA19284.1"
FT                   /translation="MKLFKNLTVQVITAVIIGVIVGLVWPDVGKEMKPLGDTFINAVKM
FT                   VIAPIIFFTIVLGIAKMGDMKKVGKVGGKAFIYFEVVTTLALIIGLFVVNIMKPGAGLD
FT                   YSKLEKGDVSQYTQNGGQGIDWIEFITHIVPSNMVDAFAKGDILQVLFFSILFGVGLAA
FT                   LGEKGKSVIDFFDKVSHVFFKIIGYIMRAAPIGAFGAMAYTIGHFGLDSIKPLASLMMS
FT                   VYITMFLFVFVALNIICKLYGFSLWNYLRFIKDELLIVLGTSSSESVLPRMMDKMERYG
FT                   CSKSVVGLVIPTGYSFNLDGTSIYLSMATVFLAQVFGVDLSIGQQITIILVLMLTSKGA
FT                   AGVTGSGFIVLASTLSALQVIPLEGLALLLGVDRFMSEGRAIVNLIGNGIATIIVAKSE
FT                   NEFDEAKSIEAVEGMKKMKTAV"
     atgaaactgt ttaaaaattt aacagttcag gtcataaccg cggtcatcat cggggtcatt        60
     gtcgggctgg tctggccgga tgtcggcaaa gaaatgaaac cgcttggtga tacatttatc       120
     aacgctgtta aaatggtgat cgcaccaatc attttcttca caatcgttct cgggattgca       180
     aaaatgggcg atatgaagaa ggttggaaaa gtagggggaa aagcgtttat ctatttcgag       240
     gttgtcacca ccctcgcact cattatcggt ttatttgtcg tcaatattat gaagccgggt       300
     gcgggtcttg attacagcaa gcttgaaaaa ggagatgtat cacaatacac gcaaaatggc       360
     ggtcagggaa tcgactggat tgaatttatt acacacattg ttccgtccaa catggttgat       420
     gccttcgcaa aaggggacat tttgcaggtc ttattctttt ctattctttt cggagtgggt       480
     cttgcggcat taggcgaaaa aggaaaaagc gtcattgatt tcttcgacaa ggtttctcac       540
     gtttttttca aaattatcgg ctacattatg cgtgccgcgc caatcggggc attcggggcg       600
     atggcgtata caatcggaca cttcgggctc gattccatca aaccgctggc aagcttaatg       660
     atgtctgttt atattacgat gttcctgttc gtatttgttg ctttaaatat catctgcaag       720
     ctttacggat tcagcctgtg gaattacctt cgcttcatta aggatgagct tttgatcgtg       780
     cttggcacaa gctcttccga atcggtgctt ccgcgtatga tggataaaat ggagcgctac       840
     ggctgttcca aatccgttgt cgggcttgtt attccgacgg gctattcgtt taacctcgac       900
     ggcacatcca tctatttatc aatggcgact gtctttttgg cacaggtgtt tggagtagac       960
     ctcagcatcg gccagcaaat tacgattatc ctcgttctga tgctgacatc gaagggagcg      1020
     gcaggtgtga cgggaagcgg atttatcgtc cttgcctcaa cgctgtcagc gctgcaggtc      1080
     attccgctgg aggggcttgc actcctgctc ggggtcgacc gtttcatgag tgaaggaaga      1140
     gccattgtga acctgatcgg aaacggaatc gccacgatca ttgttgccaa aagcgaaaat      1200
     gaatttgatg aagcaaaaag catagaggct gttgaaggca tgaaaaaaat gaaaacagca      1260
     gtctga                                                                 1266
//

If you have problems or comments...

PBIL Back to PBIL home page