(data stored in ACNUC7421 zone)

EMBL: AB001488.YDBJ

AB001488.YDBJ        Location/Qualifiers
FT   CDS_pept        35971..36897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydbJ"
FT                   /note="PROBABLE TRANSPORT ATP BINDING PROTEIN."
FT                   /db_xref="GOA:P96605"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96605"
FT                   /protein_id="BAA19286.1"
FT                   /translation="MAEPILHIEGLDKKIGSKQILKQISMDVMEGEIIGLLGPNGSGKT
FT                   TLIRIIVGLLKQNSGSVTISGFQHDTEFEKAMEAVGAIVENPEFYPYLTGWENLKHFAN
FT                   MHKKIADERLDEVVERVGLTSAIHDKVKTYSLGMRQRLGIAQAILHRPKLLILDEPTNG
FT                   LDPAGMKDFRDHIKELAEMEGTAVLFATHLLREVEDLCDRVIIIQKGEIKAEVSLQGTD
FT                   QTTEKAIIEVQPQEKALNWLTGNQYQAESQDGTIVVEVAKENIPELNRSLVGQDLNVFS
FT                   ITPYTQSLEDEFIKATTAHQEEGEELV"
     atggctgagc cgattttaca tattgaaggc ctcgataaaa aaattgggtc taaacagatt        60
     ttaaaacaga tcagcatgga cgtcatggag ggtgaaatca tcggccttct cggtccgaat       120
     ggttccggaa aaacaacact catccgtatc atcgtcgggc tgttgaaaca aaacagcgga       180
     agcgtgacaa tcagcggatt ccagcatgat acagagtttg aaaaagcgat ggaagcggtt       240
     ggagcgattg ttgagaaccc tgagttctat ccgtacctga caggctggga aaacctcaag       300
     cactttgcga atatgcacaa aaaaatagcg gatgaacggc ttgatgaagt ggtggaacgt       360
     gtcgggctga cgtcagcgat tcatgataag gtgaaaacct attcccttgg gatgcgccag       420
     cgtctgggaa tcgcccaggc aattcttcac cggccgaagc ttctcattct agatgaaccg       480
     acaaacggcc tcgatcctgc ggggatgaag gattttcggg atcatattaa ggaactcgca       540
     gaaatggaag gaacagctgt cctgttcgcc actcatttat tgcgcgaggt tgaagacttg       600
     tgcgaccgtg tcatcatcat tcaaaaaggt gagatcaaag cggaagtcag cttacaagga       660
     accgatcaaa ccacagaaaa agcgattata gaagtgcagc cgcaagaaaa agcgctcaat       720
     tggctgacag gcaatcaata tcaagctgag agccaagacg ggacgattgt agttgaggtg       780
     gcaaaagaaa acataccgga gctgaaccga tcacttgtcg gacaagatct gaatgtattt       840
     tccattacgc cttacacgca gtcactggaa gacgaattta taaaagcgac aacagctcat       900
     caagaggagg gagaagagct tgtctaa                                           927
//

If you have problems or comments...

PBIL Back to PBIL home page