(data stored in ACNUC7421 zone)

EMBL: AB001488.YDCM

AB001488.YDCM        Location/Qualifiers
FT   CDS_pept        complement(63860..64369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydcM"
FT                   /note="SIMILAR TO IMMUNITY REGION PROTEIN IN BACTERIOPHAGE
FT                   PHI-105."
FT                   /db_xref="GOA:P96630"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96630"
FT                   /protein_id="BAA19319.1"
FT                   /translation="MITIYTSKGIKHKVQSVIKTHGTNNVYEICDIQKIYILKNDLGQA
FT                   NGLLQHDKATDQYLIHINENLQHQQFVIAHELGHYFLHKRLNTFKVVNCSKVLKDKLEH
FT                   QASLFASELILTDKMLNEALPYIQGFSKEQIAAYFNVPSFVTDYKLSQIGSFSNRIYSH
FT                   EISAFG"
     gtgataacaa tttatacaag caaaggaatt aaacataaag tgcaatcagt aattaagaca        60
     catggtacaa ataatgtcta tgaaatttgt gacatccaaa aaatttatat actcaaaaat       120
     gatcttggac aagcaaacgg tttactacaa catgacaaag ccacagatca atatttaatc       180
     catatcaacg agaacctcca acatcaacaa tttgtaattg cccatgaatt agggcattac       240
     tttctccata aaagattgaa cacttttaaa gttgtgaatt gctctaaagt tctaaaagat       300
     aaacttgagc atcaagcaag cctatttgca tcagaattaa tactgacaga taaaatgctt       360
     aatgaagccc ttccatatat acagggtttt agcaaagaac aaatagcagc atacttcaac       420
     gtaccatcat ttgttactga ttataaactt tctcaaattg gctcatttag taacagaatc       480
     tattcacacg aaataagcgc ttttggttaa                                        510
//

If you have problems or comments...

PBIL Back to PBIL home page