(data stored in ACNUC7421 zone)

EMBL: AB001488.YDCN

AB001488.YDCN        Location/Qualifiers
FT   CDS_pept        complement(64366..64749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydcN"
FT                   /note="PROBABLE REPRESSOR PROTEIN."
FT                   /db_xref="GOA:P96631"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96631"
FT                   /protein_id="BAA19320.1"
FT                   /translation="MSLGKRLKEARQKAGYTQKEAAEKLNIGNNNLSNYERDYRDPDTD
FT                   TLLKLSNLYNVSTDYLLGKDEVSKKNETDLLNKTINEAIQELKDEDTLLFMNDGEFDEE
FT                   TARLVKKALKNGIKFIDELKKKE"
     atgagcctag gcaaacgatt aaaagaagct cgacaaaaag ctgggtacac tcagaaagaa        60
     gccgcagaga aacttaatat cggtaacaat aacttgtcta attacgaaag agattacaga       120
     gatcctgata cagacacact cttaaaattg agcaacttat ataacgtatc tacagactat       180
     ttattaggaa aggatgaagt aagcaagaaa aacgaaactg atttactcaa taaaacaatt       240
     aatgaagcca tacaggaatt aaaggatgaa gatacactcc tttttatgaa tgatggtgaa       300
     tttgatgagg aaactgcacg ccttgttaaa aaagcattaa aaaacggaat taaattcatt       360
     gacgaattaa agaagaaaga gtga                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page