(data stored in ACNUC7421 zone)

EMBL: AB001488.YDDL

AB001488.YDDL        Location/Qualifiers
FT   CDS_pept        80542..81717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yddL"
FT                   /note="PROBABLE PROTEIN ASP-PHOSPHATASE."
FT                   /db_xref="GOA:P96649"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR040702"
FT                   /db_xref="PDB:4I1A"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96649"
FT                   /protein_id="BAA19338.1"
FT                   /translation="MRGVFLDKDKIPYDLVTKKLNEWYTSIKNDQVEQAEIIKTEVEKE
FT                   LLNMEENQDALLYYQLLEFRHEIMLSYMKSKEIEDLNNAYETIKEIEKQGQLTGMLEYY
FT                   FYFFKGMYEFRRKELISAISAYRIAESKLSEVEDEIEKAEFFFKVSYVYYYMKQTYFSM
FT                   NYANRALKIFREYEEYAVQTVRCQFIVAGNLIDSLEYERALEQFLKSLEISKESNIEHL
FT                   IAMSHMNIGICYDELKEYKKASQHLILALEIFEKSKHSFLTKTLFTLTYVEAKQQNYNV
FT                   ALIYFRKGRFIADKSDDKEYSAKFKILEGLFFSDGETQLIKNAFSYLASRKMFADVENF
FT                   SIEVADYFHEQGNLMLSNEYYRMSIEARRKIKKGEIIDENQPDSIGSSDFK"
     ttgcggggtg ttttcttaga taaagataaa attccgtacg acttagtcac gaaaaagtta        60
     aatgaatggt atacatcaat aaaaaatgat caagttgagc aagccgagat tataaaaaca       120
     gaagtagaga aagaattgtt aaacatggaa gaaaatcaag atgccctgtt atattatcaa       180
     ctattagaat ttagacatga gataatgctg agttatatga aatctaagga aatagaagat       240
     ctcaataatg cttatgagac tataaaagaa attgagaagc aagggcaatt aactggcatg       300
     ttggaatact atttttactt ttttaagggt atgtacgagt ttaggcgtaa agaattaatt       360
     tcagcgataa gtgcttatcg aatagctgaa tcaaagttgt cagaagttga ggatgaaata       420
     gagaaagcag agtttttttt caaagtgtcc tatgtatatt attatatgaa acaaacatac       480
     ttctccatga attatgcaaa tcgtgcactc aaaatattta gagagtatga agaatatgct       540
     gtccagactg tgcgttgtca atttattgta gcaggaaact tgatcgattc attggaatat       600
     gaaagagcct tggaacaatt tttgaagtct ttggaaattt ccaaggaaag taacatagag       660
     catttaattg caatgtcaca tatgaatatt gggatttgtt atgatgaatt gaaagaatat       720
     aagaaggctt cacaacattt aattttagcg ttagaaattt ttgaaaaatc aaaacatagt       780
     ttcttaacaa agactttatt cactctaacc tatgtagaag caaaacaaca aaattataat       840
     gttgctttga tatactttag gaaagggcga tttattgccg ataaaagtga tgataaggaa       900
     tactcagcga aattcaaaat attagaggga ttattttttt ctgatggtga gactcaatta       960
     ataaagaatg cattttcata tctggcttcg agaaaaatgt ttgctgatgt tgaaaatttt      1020
     tcgattgaag tcgctgatta ttttcatgaa caaggaaatt taatgctctc taatgaatat      1080
     tatcgtatga gtattgaagc aagacgaaaa attaaaaaag gggagattat tgatgaaaat      1140
     cagccggatt ctattggcag cagtgatttt aagtag                                1176
//

If you have problems or comments...

PBIL Back to PBIL home page