(data stored in ACNUC7421 zone)

EMBL: AB001488.YDDO

AB001488.YDDO        Location/Qualifiers
FT   CDS_pept        84737..85147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yddO"
FT                   /note="PROBABLE TRANSCRIPTIONAL REGULATOR, SIMILAR TO
FT                   REGULATORY PROTEIN ASNC."
FT                   /db_xref="GOA:P96652"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96652"
FT                   /protein_id="BAA19341.1"
FT                   /translation="MIDEIDKKILDELSKNSRLTMKKLGEKVHLTAPATASRVVKLIDN
FT                   GIIKGCSIEVNQVKLGFSIHAFLNIYIEKIHHQPYLAFIETQDNYVINNYKVSGDGCYL
FT                   LECKFPSNEVLDQFLNDLNKHANYKVSIVIGK"
     atgattgatg aaatagataa aaaaatactt gatgagctgt ctaaaaatag tcgccttaca        60
     atgaaaaaat taggggaaaa agtacatctc actgcaccag caaccgcatc aagagtagta       120
     aagttaatag acaatggcat aataaaagga tgtagtatcg aagtgaatca agtgaaatta       180
     ggcttctcta tacatgcttt tcttaatatt tatatcgaaa aaatccatca tcaaccctat       240
     ttagctttta tagaaacaca agataactat gtaataaaca attataaagt tagtggagac       300
     ggttgctatt tgcttgaatg taaatttcct tcaaacgagg tattagatca atttttaaat       360
     gacttaaata aacatgcaaa ctataaagtg tcgattgtta ttggtaaata g                411
//

If you have problems or comments...

PBIL Back to PBIL home page