(data stored in ACNUC7421 zone)

EMBL: AB001488.YDDP

AB001488.YDDP        Location/Qualifiers
FT   CDS_pept        complement(85270..85719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yddP"
FT                   /note="PROBABLE TRANSCRIPTIONAL REGULATOR, SIMILAR TO
FT                   REGULATORY PROTEIN ASNC AND LRP."
FT                   /db_xref="GOA:P96653"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96653"
FT                   /protein_id="BAA19342.1"
FT                   /translation="MQIDSIDFQILQLLNKNARIQWKEIGEKIHMTGQAVGNRIKKMED
FT                   NGIIKAYSIVVDELKMGFSFTAFVFFFMNAYMHDDLLKFIATRNEISEAHRVSGDACYL
FT                   LKVTVHSQEVLNHLLNDLLKYGNYQLYLSIKEVKKHYNTSLMSDE"
     atgcaaattg attcaattga ttttcaaatt ctccaattat taaataaaaa tgctcggata        60
     caatggaaag aaatcggtga aaaaattcat atgacaggac aagcggtagg caatcgcatc       120
     aaaaaaatgg aggataacgg tatcattaaa gcatattcga ttgtggttga tgaattgaag       180
     atggggtttt cttttacagc ctttgtcttc tttttcatga atgcatatat gcatgatgat       240
     ttattgaaat ttattgctac tcgtaatgaa attagcgaag ctcatcgtgt ttcgggagat       300
     gcatgttatc ttctgaaggt aacggttcat tcacaagaag ttttaaatca ccttctgaat       360
     gatttattga agtatggaaa ctatcagctt tatttgtcta ttaaggaagt aaaaaagcat       420
     tataatactt cattaatgtc tgatgaataa                                        450
//

If you have problems or comments...

PBIL Back to PBIL home page