(data stored in ACNUC7421 zone)

EMBL: AB001488.YDDS

AB001488.YDDS        Location/Qualifiers
FT   CDS_pept        87887..89197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yddS"
FT                   /note="PROBABLE METABOLITE TRANSPORT PROTEIN, SIMILAR
FT                   PRODUCT IN E. COLI."
FT                   /db_xref="GOA:P96656"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96656"
FT                   /protein_id="BAA19345.1"
FT                   /translation="MVMTKKDTNISTQQPLWLQGYIDSPEKQNQLYKKTLKILIFSQIF
FT                   GGAGLGAGITVGALLAQDMIGSENVAGIPTALFTFGSAVAALLIGASSQRFGRRAGLAG
FT                   GFLIGGLGAIGVIIAALINSVALLFVSLLIYGAGMASNLQVRYAGTDLANEKQRATAAS
FT                   MALVSTTLGAVVGPNLVNTMGEFADSIGVPNLAGPFIMSGAAFIIAGIILLIFLRPDPL
FT                   FVSTAIANAEKKDDKVQIGGSLKNPAIDKKGIMVGAVIMILAQLIMTAIMTMTPVHMGH
FT                   HGHGLSEVGLVIGLHIAAMYLPSPLTGLLVDKFGRTTMAIASGATLLAAGLVAAIAPAD
FT                   SLSLLILALVLLGVGWNFGLLTGTALIIDSTHPSLRAKTQGTFDVLLALSGAAGGALSG
FT                   MVVAHSSYTILSISGAVLSLLLIPVVIWYFRRIQEKA"
     atggtaatga caaaaaaaga tacaaatata tcaacacagc agcctctttg gttacaaggt        60
     tatattgatt caccagaaaa acaaaaccaa ctttataaaa aaacattaaa aatcttgatt       120
     ttttcacaaa tatttggggg agcaggactt ggagctggga taacagttgg ggcgcttctt       180
     gcacaagata tgataggatc ggaaaatgta gcaggaattc caactgccct ctttactttt       240
     ggatctgccg tagctgccct gcttatagga gcatcctcac aacgttttgg tcgcagagct       300
     ggacttgcag gtggtttcct tataggcgga ttaggtgcta taggtgtgat aatcgcggct       360
     ttaattaaca gcgttgccct attatttgtt tctcttctta tttatggagc aggtatggct       420
     tctaatcttc aagttcggta tgctgggaca gaccttgcaa atgagaaaca acgggcaact       480
     gctgcaagta tggccttagt ttctactact ttaggagctg tagtaggtcc taacttagtt       540
     aatacaatgg gggaatttgc agattcaatt ggtgttccca atttagctgg tccgtttatt       600
     atgtcaggag cagcttttat aattgctgga attattctct taatttttct tcgtccagat       660
     ccgctgtttg tatcaacagc tattgcgaat gctgagaaaa aagacgataa agtacaaata       720
     ggaggaagtc taaaaaatcc tgctatagac aaaaaaggaa taatggtagg agctgtcatt       780
     atgattttag ctcaactaat catgacagct attatgacaa tgacaccggt tcacatgggt       840
     catcacggtc atggtttaag cgaagtggga ttagttatag gactccatat tgcagcgatg       900
     tatcttcctt caccattgac tggtttatta gtagataagt ttggtcgcac aactatggct       960
     attgcttcag gtgccacact tcttgccgct gggttggtgg cagctattgc accggcagac      1020
     tcattatcat tgctaatcct agcactagta ttactagggg taggttggaa ctttggttta      1080
     ctaacgggaa ctgcccttat tatagattca acacatccat ctctacgtgc aaaaacacag      1140
     ggaacattcg atgttttatt agcactatca ggagcagcag gtggagcctt gtcaggaatg      1200
     gttgttgcac attctagtta tacaatacta tcaatttctg gagccgtttt atcattgtta      1260
     ctcattccag tagttatttg gtattttaga aggattcagg aaaaagcata a               1311
//

If you have problems or comments...

PBIL Back to PBIL home page