(data stored in ACNUC7421 zone)

EMBL: AB001488.YDER

AB001488.YDER        Location/Qualifiers
FT   CDS_pept        complement(110164..111351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydeR"
FT                   /note="PROBABLE INTEGRAL MEMBRANE PROTEIN, SIMILAR TO
FT                   CHLORAMPHENICOL RESISTANCE PROTEIN OF STREPTOMYCES
FT                   VENEZUELAE."
FT                   /db_xref="GOA:P96675"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96675"
FT                   /protein_id="BAA19365.1"
FT                   /translation="MANGNKQAGQRISPSLTLLLATACGIIVANLYYAQPLVGLISKAI
FT                   GLSPSGAGLIVTLTQIGYVAGLLFLVPLGDIIENKKLIVVSLLLSAAALTLTAFVKHGT
FT                   LFLAAAFFVGLGSIAAQVLVPFASYLASDAARGRVVGNVMSGLLLGIMLSRPISSLVAD
FT                   IWGWNAIFALSAVVSVILAIVLSKVLPARKPTANTNYTALLGSMWKLLRTTPVLRRRAI
FT                   YHAFVFGAFSLFWTTVPLLLSGPDFHFSQKAIALYALVGIAGAVTAPIGGRLADRGLTR
FT                   LATGIALGVVVVSLLLPLMIQSSSPVGITVLVAAAILLDMGVSANLVLSQRAIFSLAPE
FT                   IRSRLNGLFMAIFFLGGAIGSSIGGWAYASGGWSTALWIGIAFPVIALLYFITEK"
     atggctaatg gaaacaaaca agcaggtcag aggatttcac ccagtttaac ccttcttctc        60
     gcaactgcat gcggtatcat tgttgctaat ctttactatg cacaaccctt ggtcggatta       120
     attagtaagg caattggact ttctccaagc ggtgctggat tgattgtcac actcacccaa       180
     atcggatacg ttgccggctt actattcctt gtccctttag gagatattat cgaaaacaaa       240
     aaacttattg ttgtatcgct ccttctaagc gcagcggctt tgacactaac agcatttgtg       300
     aagcatggaa cactgttttt agcagctgcg tttttcgtcg gattgggatc aatcgcagcc       360
     caagtgcttg ttccatttgc atcatacctt gcatcagacg ctgcacgcgg ccgggttgtt       420
     ggcaatgtca tgagcggctt attactcggt attatgcttt cccgtccgat atctagtcta       480
     gtcgctgata tctgggggtg gaatgcaata ttcgctttgt ccgccgtggt aagtgttatc       540
     ctggccatcg tattatcaaa agtgcttcct gccagaaaac caacagcaaa tacaaactat       600
     actgccttac tcggttcaat gtggaagctg ctgcgcacga ctccagtctt acgccgccgt       660
     gccatctatc atgcgtttgt atttggagct ttcagcttgt tctggacaac tgttccttta       720
     ttattgtccg gtcctgattt tcatttttct cagaaggcaa tagcactcta cgcattggtg       780
     ggcattgcgg gtgcagtcac tgcaccaata ggcggccgcc tggctgatcg aggcttaacc       840
     aggcttgcca ctggaatcgc tctcggtgtt gtcgttgtct ctttattact gccgctcatg       900
     attcagagca gctcccccgt cggtataaca gttctagtgg ccgctgctat tctgttagat       960
     atgggtgtat ctgcaaacct tgtgctcagt caacgtgcta ttttttcgtt ggcgcctgaa      1020
     attcgcagtc gattaaacgg attattcatg gcgatcttct ttctaggcgg tgcgataggg      1080
     tcatcaattg gaggatgggc atatgcctca ggcggatgga gtacagcatt atggattgga      1140
     atcgcttttc cggtcatcgc tttgctttat ttcatcacag agaaataa                   1188
//

If you have problems or comments...

PBIL Back to PBIL home page