(data stored in ACNUC7421 zone)

EMBL: AB001488.YDFA

AB001488.YDFA        Location/Qualifiers
FT   CDS_pept        113107..114414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydfA"
FT                   /note="SIMILAR TO ARSENICAL PUMP MEMBRANE PROTEIN."
FT                   /db_xref="GOA:P96678"
FT                   /db_xref="InterPro:IPR000802"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96678"
FT                   /protein_id="BAA19368.1"
FT                   /translation="MTSMILAVFIFLLTLVLVIWQPKNLSIGWSACGGAVLALIAGVVN
FT                   FHDVLTVTGIVWNATLAFVAIILISLILDNIGFFEWAALHMAKAAKGYGVRMFVYVSLL
FT                   GAIVAALFANDGAALILTPIVLAMVRALHFNEKLVFPFIIASGFIADTTSLPFVVSNLV
FT                   NIVSADYFHITFIDYASRMVVPYLFSLLASIIVLYLFFRKSIPKRYDLTEVKKPVEAIK
FT                   DQNMFRLSWYILGLLLIGYFASEFFSIPVSVVAGSIAIIFLIAAQKSPAVHTKKVVKEA
FT                   PWAIVFFSIGMYVVVYGVRNAGLTDVLSDVIQAAADQGLFAGTIGMGFIAAILSSIMNN
FT                   LPTVMIDALAIAGTDTHGMMREALIYANVIGSDLGPKITPIGSLATLLWLHVLSHKGMK
FT                   ISWGTYFKTGIILTIPTLLITLVGLYIWLLIIHSCF"
     ttgacatcaa tgattttggc agtattcatc tttttattaa ctctagtatt ggtcatatgg        60
     cagccgaaaa atttatctat agggtggtca gcctgtggag gcgcagtttt agctctaata       120
     gcaggtgttg tcaattttca tgatgtgtta actgtgacag ggattgtttg gaatgcgacc       180
     ttggcttttg tggccatcat actgatatcg ttaattcttg ataatatcgg tttctttgaa       240
     tgggcagcgc ttcatatggc taaggctgca aaaggatacg gtgtgcggat gttcgtttat       300
     gtatctctat taggagctat cgtcgccgcg ttatttgcaa atgacggtgc agctcttata       360
     ttgacaccaa tcgtattagc gatggtcaga gcattacatt ttaatgaaaa attagttttt       420
     ccttttatca ttgccagcgg atttattgcg gataccactt cgcttccttt tgtagtaagc       480
     aatttggtca acattgtttc agcggactat tttcatatta cgtttattga ttatgcatcc       540
     agaatggttg tcccgtacct gttttcgctg ctggcgagca tcattgtact ttaccttttc       600
     tttagaaaaa gcataccaaa acgctatgat ctgactgagg ttaaaaaacc tgttgaagca       660
     attaaagatc aaaacatgtt cagactgtca tggtatatct tagggctgct gttaattgga       720
     tattttgcaa gtgaattttt ttctatccct gtatcagtgg tagcgggcag cattgcaatc       780
     attttcttaa tcgctgcgca aaagagtccg gccgtccata caaagaaagt ggtgaaagag       840
     gcgccatggg ctatcgtatt cttttcaatt ggcatgtacg ttgttgtgta tggtgtccga       900
     aatgccggat taacggatgt cctttcagat gtgattcaag ccgcagctga tcaaggattg       960
     tttgctggga caattggaat gggctttatt gcggcgattc tttcttccat tatgaataac      1020
     ttgccgactg ttatgattga cgcattggcc attgccggta cagatacaca tgggatgatg      1080
     agagaagcgc ttatttatgc aaatgtgatc ggttcagatt tagggcctaa aataacaccg      1140
     attggttcct tagcgacatt attatggctt catgttcttt cgcacaaagg tatgaagatt      1200
     tcctggggca cgtattttaa aacaggaatt atcctcacga tacccacttt attgatcaca      1260
     cttgtcggcc tgtatatttg gctgctgata atccattctt gtttctaa                   1308
//

If you have problems or comments...

PBIL Back to PBIL home page