(data stored in ACNUC7421 zone)

EMBL: AB001488.YDFH

AB001488.YDFH        Location/Qualifiers
FT   CDS_pept        120962..122185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydfH"
FT                   /note="POBABLE SENSORY TRANSDUCTION HISTIDINE KINASE."
FT                   /db_xref="GOA:P96685"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96685"
FT                   /protein_id="BAA19375.1"
FT                   /translation="MLIRNPFKDKYYSHDRRALNMLALRVPGLAFILMIYIASIVLQFV
FT                   SGGWSILLLYAFTILIAIFALLHWHSYRWVKKRVILYFAVQGLITFALANLMTGFFILV
FT                   IIGLYAFLIGQIIGMADRRRTFLILYLLLLLVINSAYHLHKGEVLHFIVIAAPIMIVII
FT                   TYAATFFAQVDEKIKAQLTLERLELAHQQVEQLTLQNERQRMARDLHDTLAQGLVSLNM
FT                   QLDAIHVHLAKGNTERAKEIIQQSMKRVKSTIADARSAIDDLRSKSEEIGVLKERITSL
FT                   MDHFIESTGMACLLDYRLHQVLDVRTAENCYYIIGECMTNAAKHAEAKTIWISIWDDEK
FT                   GRLHLTVKDNGKGFDVEKGKKKRGHYGLLGIQERVRAINGQFNIKSTKLKGTQIEITVP
FT                   IQGEMQDE"
     ttgcttataa ggaatccttt taaagataaa tattactcac atgataggcg ggcattaaac        60
     atgcttgcac tcagagtgcc gggcctggct tttattctca tgatctatat agcctctatc       120
     gtgctgcaat ttgtttctgg gggctggtcc attttattgc tttatgcgtt taccatatta       180
     atcgccattt ttgctttgct tcattggcac tcatatcgct gggttaagaa aagagtgatt       240
     ctgtatttcg cggtacaagg tttgatcacc tttgcacttg ctaatctcat gactggcttc       300
     tttatacttg tgattatcgg cctttatgca tttttaattg gacaaattat aggaatggca       360
     gacagaagaa ggacttttct cattctttat ctattgctgc tgctggtcat aaattcggcg       420
     tatcaccttc ataaaggtga agttttgcat tttattgtta ttgctgcgcc gatcatgatt       480
     gtcatcatca cttatgccgc aacatttttt gcccaagtcg atgaaaaaat aaaagctcaa       540
     ttgactcttg aaaggctgga gctggctcat cagcaggtag aacagctgac gctgcagaac       600
     gaaagacagc ggatggcccg agacttacac gatacgcttg ctcaaggtct tgtcagttta       660
     aatatgcagc tggatgcgat tcatgttcat ctcgccaaag gcaacacaga gagagcgaag       720
     gaaatcatac aacaatcgat gaaaagagtg aaaagcacaa tagctgatgc acgttcagct       780
     attgacgatc tccgcagcaa atcagaagaa atcggtgttt taaaagaaag aattacctcg       840
     ctaatggatc attttataga gtcgacaggc atggcttgtt tattagatta cagattgcat       900
     caggtgctgg atgtgcgtac agctgaaaac tgttattaca tcattggaga atgcatgacg       960
     aatgcggcaa agcatgctga ggcgaaaaca atctggatat ccatttggga tgatgaaaag      1020
     ggaaggctcc atttaacagt taaggataac ggcaagggat ttgatgttga aaaaggaaag      1080
     aaaaagagag gacattatgg gcttcttggc atacaagaac gcgtcagggc aataaatggc      1140
     caattcaata tcaagagtac aaaattgaaa ggaacacaaa ttgagatcac tgtaccaatt      1200
     cagggagaga tgcaagatga ataa                                             1224
//

If you have problems or comments...

PBIL Back to PBIL home page