(data stored in ACNUC7421 zone)

EMBL: AB001488.YDFJ

AB001488.YDFJ        Location/Qualifiers
FT   CDS_pept        122935..125109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydfJ"
FT                   /note="PROBABLE TRANSPORT PROTEIN, SIMILAR TO ANTIBIOTIC
FT                   TRANSPORT-ASSOCIATED PROTEIN ACTII IN STREPTOMYCES
FT                   COELICOLOR."
FT                   /db_xref="GOA:P96687"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96687"
FT                   /protein_id="BAA19377.1"
FT                   /translation="MSKMLYTLGGWVARNRIKAICAWIVVLVAAIGLAVTLKPSFSEDM
FT                   SIPDTPSEKAMDVIQKEFPHGPDKGSIRVIFGAGDGEKLTGKPAKKAIEDTFKEISKDD
FT                   SVDSIASPFVTGTIAKDGTVAYADIQYKSSADDIKDYSIKHLKDSLKMADDEGLQTELS
FT                   GDVPGAEMEIGGVSEIVGIILAFVVLAITFGSLLIAGLPILTALIGLGVSIGLVLIGTQ
FT                   VFDIASVSLSLAGMIGLAVGIDYALFIFTKHRQFLGEGIQKNESIARAVGTAGSAVVFA
FT                   GLTVIVALCGLTVVNIPFMSAMGLTAGLSVLMAVLASITLVPAVLSIAGKRMIPKSNKK
FT                   IEKQSTETNVWGRFVTKNPIMLSVCSILILIVISIPSMHLELGLPDAGMKAKDNPDRRA
FT                   YDLLAEGFGEGFNGQLTIVADATNATENKAEAFADAVKEIKGLDHVASVTPAMPNKEGN
FT                   FAIITVVPETGPNDVTTKDLVHDVRSLSDKNGVDLLVTGSTAVNIDISDRLNDAIPVFA
FT                   VLIVGFAFVLLTIVFRSLLVPLVAVAGFMLTMTATLGICVFVLQDGNLIDFFKIPEKGP
FT                   ILAFLPILSIGILFGLAMDYQVFLVSRMREEYVKTNNPVQAIQAGLKHSGPVVTAAGLI
FT                   MIFVFAGFIFAGEASIKANGLALSFGVLFDAFIVRMTLIPSVMKLMGNAAWYLPKWLDK
FT                   IIPNVDIEGHQLTKEIQPEIDHEQKKQISV"
     atgtcaaaaa tgttatatac attaggagga tgggttgctc gcaatcgcat aaaagcaata        60
     tgtgcgtgga tcgttgtgtt agttgctgcg ataggccttg cagtgacctt gaaaccaagt       120
     ttttctgagg atatgtccat acctgacaca ccttcggaaa aagcgatgga tgtgattcaa       180
     aaagaatttc ctcatggtcc tgataaaggg agcatacggg ttattttcgg tgctggtgat       240
     ggggagaaac ttactgggaa gccagcaaaa aaagcaatag aagatacgtt caaagaaatc       300
     agtaaagatg attctgttga ctcgattgca agtccttttg tgacagggac aatcgcgaaa       360
     gatggcacag ttgcctatgc tgatatccag tataaatcat cagcagatga tataaaggat       420
     tactctatca aacacttaaa agacagtttg aaaatggctg atgatgaagg attgcaaact       480
     gagctaagcg gagatgtacc gggagcggag atggagatag gcggtgtctc tgaaattgtc       540
     ggcattatct tggcttttgt cgttttagcc attacattcg gttctttatt aatagcaggt       600
     ttgccgattt taactgcact gattggttta ggtgtaagta ttggactggt tttgattggg       660
     acacaagtat ttgatattgc ttctgtcagt ctttcattag ccggaatgat tggccttgct       720
     gttggtattg attatgcttt atttattttt acgaaacacc gccagttttt aggcgaaggc       780
     atacaaaaga atgaatcaat tgcgagagcc gtgggaacag cgggaagtgc agtggttttt       840
     gccggactta ctgttatcgt tgcactttgc ggattaactg tcgttaacat tccttttatg       900
     tctgcgatgg ggctgacagc agggcttagt gtactgatgg ctgttttggc ttccatcaca       960
     cttgtgcctg cggtcttatc gattgcaggg aagcggatga ttccgaaatc aaacaagaaa      1020
     atagaaaaac aaagcactga aacaaatgtc tggggacgct ttgtcaccaa aaatcctatc      1080
     atgctaagtg tatgcagcat tctgattttg atcgtcatta gtatcccatc tatgcatttg      1140
     gaactgggct tgcctgatgc tgggatgaaa gctaaggata atccggatcg ccgggcatat      1200
     gacttgcttg ccgaaggctt tggagaagga tttaatggcc aattaacaat cgtagcggat      1260
     gccacaaatg ctacagaaaa taaggcggag gctttcgcag atgcagtgaa agaaataaag      1320
     ggcttagacc atgtagcaag tgtcactcct gcaatgccta ataaagaagg gaactttgcc      1380
     atcattacgg tcgttcctga aacaggtcca aatgatgtca caacgaaaga tttggtacat      1440
     gatgtacgca gtttatcaga taaaaacgga gtagatttgc ttgttactgg atcaactgca      1500
     gtgaatattg acatttcaga tcgcctgaat gatgcgatac cggtgtttgc tgtacttatt      1560
     gttggctttg cgtttgtatt gctgaccatc gttttccgtt cgctgcttgt gccgcttgtt      1620
     gctgttgcag gtttcatgtt gacgatgaca gccactcttg gaatctgtgt atttgtcttg      1680
     caagacggga atctcatcga ctttttcaaa atacctgaaa aagggccgat actcgcgttc      1740
     ctgccgattt tatcgattgg gattctgttc gggttagcca tggattatca agtattcctt      1800
     gtcagcagaa tgcgtgaaga atatgtaaaa acaaacaatc cagtacaagc cattcaggct      1860
     ggattaaaac acagtggtcc tgttgttaca gcagccggct tgatcatgat cttcgttttt      1920
     gcaggattta tctttgcagg cgaagcttct attaaagcca atgggctggc tctttccttt      1980
     ggtgtactct ttgatgcctt tattgtaaga atgacactga ttccaagtgt catgaagctg      2040
     atggggaatg cagcctggta tttgccgaaa tggttagaca agattattcc gaatgtggat      2100
     atagaagggc atcaactgac aaaggaaata cagccggaaa tagatcatga acaaaagaaa      2160
     caaatcagtg tgtaa                                                       2175
//

If you have problems or comments...

PBIL Back to PBIL home page