(data stored in ACNUC7421 zone)

EMBL: AB001488.YDFL

AB001488.YDFL        Location/Qualifiers
FT   CDS_pept        complement(127404..128216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydfL"
FT                   /note="PROBABLE REGULATORY PROTEIN, SIMILAR TO
FT                   MULTIDRUG-EFFLUX TRANSPORTER REGULATORS IN B.SUBTILIS."
FT                   /db_xref="GOA:P96690"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010499"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="InterPro:IPR029442"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96690"
FT                   /protein_id="BAA19380.1"
FT                   /translation="MKEFFSIGEVSKLFNVKISALRYYDEIGLLKPEYKDEQTNYRYYS
FT                   TQQFERLDTIKYLRALGLPINKLLDFYNSQNTNTLLHLLKSQQVEIDRKKKELERIERK
FT                   ISRRITHIEDAVNMPLHQISKIKLPAMRVAYLQHEYVLGHDIEHSLAELRTHLNVNEDI
FT                   FIGKIGLSISAANVKAKQFDKYSSIFMILEDENEKTSSEIIFPSREYLQIRFKGSHPEA
FT                   EPYYKKLLAYMKEHHYEVAGDSIEITLIDYGITNNLDNYVTEILLPIK"
     atgaaggaat ttttttcgat tggagaagtg tcaaagttat tcaatgtgaa aatctctgct        60
     cttcggtatt atgatgaaat cggccttttg aaaccggaat ataaagatga gcaaacgaac       120
     tatagatatt attctaccca acagtttgag cggctggata ccatcaagta tttgagggcc       180
     ctaggcctgc caatcaataa gcttcttgat ttttataact ctcaaaatac aaacactctt       240
     cttcatttac taaaaagcca gcaggttgaa attgatcgca agaagaaaga attggaacgc       300
     attgaacgaa agatctcccg acgcatcaca catatagaag atgccgttaa catgccgtta       360
     catcaaattt caaaaatcaa acttcccgca atgcgtgtgg cctatttgca gcatgaatat       420
     gttctcggcc atgatatcga acattcgtta gctgaattga gaacccacct gaatgtaaac       480
     gaagatatat tcataggcaa gattggttta tccatttctg cagcaaatgt gaaagcaaaa       540
     cagtttgaca aatattccag tatatttatg attcttgaag atgaaaatga aaaaacttct       600
     tcagaaatca tctttccttc aagagaatat ctgcaaatta ggtttaaagg gtcacatcca       660
     gaagccgaac catactacaa aaaattactg gcatatatga aagaacatca ttatgaggta       720
     gcaggggact caatcgaaat cacactcatt gattatggca ttacgaataa cctagataat       780
     tacgtgactg aaatcctgct gcccatcaaa taa                                    813
//

If you have problems or comments...

PBIL Back to PBIL home page