(data stored in ACNUC7421 zone)

EMBL: AB001488.YDFO

AB001488.YDFO        Location/Qualifiers
FT   CDS_pept        130332..131270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydfO"
FT                   /note="SIMILAR TO PENTACHLOROPHENOL-INDUCED PERIPLASMIC
FT                   PROTEIN IN FLAVOBACTERIUM SP"
FT                   /db_xref="GOA:P96693"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="PDB:3OAJ"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96693"
FT                   /protein_id="BAA19383.1"
FT                   /translation="MAKKTMGIHHITAIVGHPQENTDFYAGVLGLRLVKQTVNFDDPGT
FT                   YHLYFGNEGGKPGTIITFFPWAGARQGVIGDGQVGVTSYVVPKGAMAFWEKRLEKFNVP
FT                   YTKIERFGEQYVEFDDPHGLHLEIVEREEGEANTWTFGEVTPDVAIKGFGGATLLSEQP
FT                   DKTADLLENIMGLERVGKEGDFVRYRSAGDIGNVIDLKLTPIGRGQMGAGTVHHIAWRA
FT                   NDDEDQLDWQRYIASHGYGVTPVRDRNYFNAIYFREHGEILFEIATDPPGFAHDETQET
FT                   MGEKLMLPVQYEPHRTQIEQGLLPFEVRELD"
     atggctaaaa aaacgatggg aattcatcat attacagcga ttgtcggtca ccctcaagag        60
     aacacagatt tttacgcagg agtgcttggg cttcgtttgg tcaagcaaac tgtcaatttt       120
     gatgacccag gtacgtatca tctttatttt gggaatgaag gcgggaagcc gggaacaatc       180
     attaccttct ttccgtgggc cggagcccgc caaggcgtca ttggagacgg tcaagttggc       240
     gtgacttcgt atgtcgtgcc gaaaggggct atggcatttt gggaaaagag actagaaaag       300
     ttcaacgttc cctacaccaa aatcgagcgc tttggggaac aatatgtaga atttgatgat       360
     cctcatggac tgcacttaga aatcgtggaa agagaagaag gagaggctaa tacgtggact       420
     ttcggagaag taacgcccga tgttgccatt aaaggttttg ggggtgcaac cctattatca       480
     gagcagcctg acaaaaccgc tgacctttta gaaaacatca tggggctgga gcgagtcggc       540
     aaagaaggag acttcgttcg ttatcgttcc gccggtgata tcggaaatgt gattgacctt       600
     aagttaacgc ctattggccg cgggcaaatg ggggccggaa cggtgcatca catcgcttgg       660
     cgggctaacg atgatgaaga tcagttagat tggcaaagat atattgcttc ccacggatat       720
     ggtgtaactc ctgttcggga tagaaactac tttaatgcca tttacttcag ggaacacggg       780
     gaaatcctgt ttgaaatcgc aactgatccc ccaggctttg cacatgatga aacacaggaa       840
     acaatgggcg aaaaactgat gctgcctgtg caatatgaac cgcatcgcac acaaattgaa       900
     caagggctgc tgccgtttga agtaagagag ttagattga                              939
//

If you have problems or comments...

PBIL Back to PBIL home page