(data stored in ACNUC7421 zone)

EMBL: AB001488.YDGF

AB001488.YDGF        Location/Qualifiers
FT   CDS_pept        complement(139917..141293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydgF"
FT                   /note="PROBABLE AMINO ACID TRANSPORT PERMIASE."
FT                   /db_xref="GOA:P96704"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96704"
FT                   /protein_id="BAA19395.1"
FT                   /translation="MTDDMTKDNINQQTLQRGLKNRHIQLIAIGGAIGTGLFLGSGKSI
FT                   HFAGPSILFAYMITGIICFLIMRSLGELLLSNLNYHSFVDFVQDYLGDMAAFITGWTYW
FT                   FCWISIAMADLTAVGLYTQYWLPGVPQWVPGLIALIILLIMNLATVKLFGELEFWFALI
FT                   KVIAILALIVIGLVMIFKGFSTSSGVSSFTNLWSHGGLFPNGMHGFILSFQMVVFAFVG
FT                   IELVGLTAGETENPEKVIPKAINNIPVRVLLFYIGALLVIMSIYPWDIINPSESPFVQV
FT                   FVAVGIVGAASIINFVVLTSAASACNSAVFSTSRMVYSLAKDHNAPESMAKLTQRKVPR
FT                   NALFFSAIVILIGVTLNYIMPEGVFTLITSISTVCFIYIWGITVICHMKYRKTRPELAK
FT                   TNKFKLPLYPFTNYLILAFLAFVLVVLALAQDTRVSLFVTPVWFILLIVIYKVRKAKHQ
FT                   "
     gtgacagacg acatgacgaa agacaatata aatcagcaaa cgttgcagag aggcttgaaa        60
     aacaggcata tccagctcat cgccatcggc ggagccattg ggacaggctt atttctcggc       120
     tcgggcaaat cgattcattt tgccggacct tcgattttat ttgcttatat gatcacaggg       180
     atcatttgct ttttaattat gagatcgctg ggtgaactgc tgttatcaaa cttgaactat       240
     cactcttttg tggattttgt acaagactac ctaggcgata tggcagcttt tatcaccggc       300
     tggacatatt ggttctgctg gatttccatt gcgatggctg atctgacagc agtcgggctc       360
     tacactcaat attggctccc gggtgtgccg caatgggtgc ctggcttaat cgctcttatt       420
     attttactga ttatgaatct ggcgacagtc aagctttttg gagaattaga attttggttc       480
     gctttgatta aagtcattgc cattttggcg ttaatcgtca ttggccttgt gatgattttc       540
     aaaggctttt ccacaagctc aggagtgtcc agcttcacaa acctctggag ccacggaggc       600
     ctgttcccga atggcatgca cgggtttatc ctctcgttcc agatggttgt gtttgctttt       660
     gtcggcattg agcttgtcgg gcttacggcc ggtgaaacag aaaaccctga aaaagtaatc       720
     cctaaggcga tcaacaatat tcctgtccgt gtgctgcttt tttatatcgg ggctcttctc       780
     gtgattatga gcatctatcc ttgggatatc atcaatccca gcgaaagccc attcgtacaa       840
     gtatttgtcg ctgttggcat cgtcggggct gcaagtatta tcaactttgt tgtgttgaca       900
     tccgctgctt cagcatgcaa cagcgctgta ttcagtacaa gccgtatggt ctattccctg       960
     gcgaaagatc acaatgcgcc tgagtcaatg gcgaaactga ctcagcgtaa agtgcctaga      1020
     aatgctttat tcttttcagc tatcgtgatt ttaatcggtg ttacgttaaa ctacatcatg      1080
     ccagaaggcg tattcaccct gatcacaagt atttcaaccg tatgctttat ctacatttgg      1140
     gggattacgg tcatctgcca tatgaaatac cgcaaaacaa gacctgaatt agcgaaaaca      1200
     aacaagttta agcttccgct ttatccgttt acaaattacc tgattcttgc gttcctggcg      1260
     tttgttctgg ttgtgctggc actggcacag gatactcgtg tttccttatt tgtcacaccg      1320
     gtttggttta ttttgctgat tgtgatttat aaagtgagaa aagcgaagca tcaataa         1377
//

If you have problems or comments...

PBIL Back to PBIL home page