(data stored in ACNUC7421 zone)

EMBL: AB001488.YDGH

AB001488.YDGH        Location/Qualifiers
FT   CDS_pept        142607..145264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydgH"
FT                   /note="PROBABLE TRANSPORT PROTEIN, SIMILAR PRODUCT IN
FT                   MYCOBACTERIUM LEPRAE."
FT                   /db_xref="GOA:P96706"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96706"
FT                   /protein_id="BAA19398.1"
FT                   /translation="MRAIIKFKWAIAAIVLALTVVLSLFSPNLTELANQKGQAQLPADA
FT                   VSERANAILKQAGEDNNSISVVFTLDNAIKKETENQLRIIIDKIKKIDGVEEVTSPLSA
FT                   EKEVKDQLMSKDKKTVLMPVTITGSDKKAEKIADEIYQIVPDDLTAYITGASLINQDFA
FT                   HSSEEGLKKTEVITVCLIIGLLLIVFRSVVTPFIPIVVVGFSYLISQSILGILVYNVDF
FT                   PISTFTQTFLVAILFGIGTDYCILLLTRFREELANGHDKKEAALIAYRTGGKTLFISGF
FT                   AVLIGFSALGFAKFAIFQSAVGVAVGVGILMIILYTLLPLFMVTLGEKLFWPSKKVLSH
FT                   SDNKLWAFLGRHSVARPFLFIVITVVITLPFILTYDDQISFDSTAEISSDYKSIKALEA
FT                   IKDGFGEGKAFPINVVVKGDKDLTTADTIPYLGNISKAIEKVDHVDSVMTITQPTGKKI
FT                   KDLYIDNQLGSVSDGLDKTVKGIADVQSGLTDIENGLNQMAGQTGSASNGGSGGSLGDA
FT                   ADGLGKINQQLQLVSKQISQTGNTAQTVQQLTAISGQLGQIQTGLEQANQQLSGQQAQA
FT                   GTLTESLKKLSEGVKSANEGLTKVSDGITASSDILEDMSKSPTVRDTGIFIPDQVMKDK
FT                   DFKKSIDQYSFADGKGVQLSVVLDSNPYSEQAITTINQIKKAVANEVDGTPLENAQIVY
FT                   GGVTSMNADLKELSTTDFSRTMVIMIIGLFIVLTILFRSMIMPIYMIASLLLTYYTSIS
FT                   ITELIFVNGLGNAGVSWAVPFFSFVILIALGVDYSIFLLDRFKEEVHLGIEQGVVRSMS
FT                   KMGSVIITAAIILAGTFAAMMPSGVNTLMQVASVIIIGLLLYGLVILPLFIPAIIATFG
FT                   EGNWWPFGRKKGKE"
     atgagagcaa tcatcaaatt caagtgggca attgcagcca tagtattagc acttaccgtc        60
     gttttgagtt tgttttctcc gaacttaacg gagctggcca atcaaaaggg gcaggcccag       120
     cttcccgctg atgctgtttc agaaagggca aacgccattt taaaacaagc gggagaagac       180
     aataattcga tcagtgtagt ctttacatta gacaacgcta taaagaaaga aacagagaat       240
     cagctccgga taataattga taaaatcaaa aagatcgacg gtgtagaaga ggtaacatct       300
     cctctgtcag cggaaaaaga agtcaaagac cagttgatgt cgaaagacaa gaaaaccgtt       360
     ctcatgcctg tcacgattac aggttctgat aaaaaggcgg aaaaaattgc ggacgagatt       420
     tatcaaatcg ttcctgatga cttgacggca tatattacgg gagcttccct tatcaaccag       480
     gatttcgctc acagctcaga ggaagggctt aagaaaacgg aagtgataac agtctgcctg       540
     atcatcggtt tactgttgat cgtgttccga tctgttgtga cgccttttat cccgattgtg       600
     gttgtcggtt tttcttatct gatcagtcaa tctatactgg gcatccttgt atacaatgtt       660
     gattttccta tctcgacgtt tacgcaaacc ttcttagttg cgatcctgtt cggcattgga       720
     acagattact gcatactgct tcttacacgg ttccgtgaag aattggcaaa cgggcatgat       780
     aaaaaagaag cggcgcttat cgcttaccgc acagggggaa aaaccttatt tatcagcgga       840
     tttgcggtat tgatcggatt ttccgcctta ggatttgcga agtttgcgat tttccaatcc       900
     gcagtagggg tagcagtcgg tgtgggaatt ttaatgatca tcctctacac actgctgcca       960
     ttatttatgg tgacgctggg tgaaaaatta ttctggcctt ctaagaaagt gctgtcacac      1020
     agtgataaca aactatgggc gtttctcggc agacactccg ttgcgcgtcc gtttctgttc      1080
     attgtcatca cggtggtgat tacgcttccg ttcatcttga cctatgatga ccagatttca      1140
     ttcgactcaa ctgcggaaat cagcagcgat tataaatcta taaaagctct cgaggccatt      1200
     aaggatggat tcggggaagg aaaagcgttc ccgatcaatg ttgtcgtaaa aggagacaaa      1260
     gatcttacaa cagctgatac aatcccctat ctaggaaata tcagcaaagc gatcgagaaa      1320
     gttgatcatg ttgactctgt tatgaccatt acgcagccga ctggtaaaaa aatcaaagat      1380
     ttatatattg ataaccagct aggatcggtt tcagacgggc tggataagac ggtgaaaggg      1440
     attgccgatg tccaaagcgg attaacggat atagaaaacg gactgaatca aatggcaggg      1500
     caaaccggct cggcctcaaa tggagggtct ggcggttcac tgggcgatgc ggcagatggc      1560
     ttgggcaaaa tcaatcagca gctgcagctc gtgagcaaac agatttccca aaccggcaat      1620
     accgcacaga ccgtgcagca gcttacggca ataagcggac agcttggcca gattcaaacc      1680
     ggccttgaac aagcgaacca acagctctca ggccagcagg cacaagccgg aacgctgaca      1740
     gaaagcctga aaaagctgtc cgaaggcgtg aaaagcgcaa atgagggcct gacgaaagtc      1800
     tctgacggta ttacagcttc cagtgatata ttagaggaca tgagcaaaag tccaactgta      1860
     agagatactg gcatattcat tcctgatcaa gtaatgaagg acaaagactt taagaagtca      1920
     attgaccagt attcctttgc agacggcaaa ggtgttcaat taagtgtcgt tctggattca      1980
     aatccgtact cagaacaagc tattacgaca ataaaccaaa tcaaaaaagc tgtcgcaaac      2040
     gaagttgacg gcactccttt ggagaatgca cagatcgtgt acggcggggt cacgagtatg      2100
     aatgcggact taaaggagct atccacaacg gacttctcca gaacaatggt gattatgatt      2160
     ataggcctgt ttatcgtgtt aaccattttg ttccgctcaa tgatcatgcc gatttatatg      2220
     atcgcgtcat tgctgctgac gtactatacg tcgatatcca taacagaatt aatttttgta      2280
     aacggcttag gaaacgcggg tgtcagctgg gcagtgccat tcttcagctt tgtcatcttg      2340
     atcgcgttag gggtagatta ttcgatcttc ttgctggatc gatttaagga agaggtgcac      2400
     cttggcattg agcaaggtgt cgtcaggtca atgagcaaaa tgggatctgt cattattaca      2460
     gctgccatta tattggccgg tacgttcgcg gcgatgatgc cttcaggtgt caatacactg      2520
     atgcaggtgg caagtgttat catcatcggg ctcttgcttt acggccttgt catacttccg      2580
     ctcttcatcc cggcaatcat tgcgaccttt ggagaaggaa actggtggcc gttcggcagg      2640
     aagaaaggaa aagagtaa                                                    2658
//

If you have problems or comments...

PBIL Back to PBIL home page