(data stored in ACNUC7421 zone)

EMBL: AB001488.YDGK

AB001488.YDGK        Location/Qualifiers
FT   CDS_pept        146860..148068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydgK"
FT                   /note="SIMILAR TO BICYCLOMYCIN RESISTANCE PROTEIN."
FT                   /db_xref="GOA:P96709"
FT                   /db_xref="InterPro:IPR004812"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96709"
FT                   /protein_id="BAA19401.1"
FT                   /translation="MLHNPTGKERLALAFLLGMLAILGPLNIDMYLPSFPEIAKDLSAS
FT                   ASLVQLSLTACLVGLTIGQLIVGPVSDAQGRRKPLLICIFLFALSSLFCALSPNITTLV
FT                   AARFLQGFTASAGLVLSRAIVRDVFTGRELSKFFSLLMVITAVAPMVAPMTGGAILLLP
FT                   FATWHTIFHVLMIIGFLLVLLIALRLKETLPLEKRIPSSIGTSVKTMGSLLKDRSFMGY
FT                   ALTVGFIHGGSFAYVSGTPFVYQDIYGVSPQVFSILFGINGLAIISGSFIIGRFGGIIH
FT                   EKSLLRIAVITAMIATAVLLTMTMIHGPLATLVISIFIYMITIGMVLTSTFTLAMEKQG
FT                   HRAGSASALLGMLPLLLGSIVSPLVGINETTAVPMGAIMFVTAVIGSLAFFGLTKERVG
FT                   QNS"
     atgctgcaca atccaactgg aaaagaacgc ttggcactag cgtttctgct cggcatgctt        60
     gctatattgg gcccgcttaa tatagatatg tatttgccaa gttttcctga aatcgcgaaa       120
     gatttatcag caagtgcttc acttgttcag ttaagtttaa cagcctgtct ggtcgggctt       180
     acgatcggcc agctgattgt cgggccggtc agcgatgcgc agggaagacg aaaaccgcta       240
     ttaatctgta tttttttatt tgcgttatct tctctgtttt gtgcactgtc gcccaatata       300
     acaactttag tggctgcgcg ttttttacaa ggcttcactg cttctgcagg gcttgtgctg       360
     tctcgcgcaa tcgtccgcga tgtgtttacc ggaagagagc tttctaaatt tttctcgctg       420
     ttaatggtca ttaccgcggt ggcgccaatg gttgcgccta tgacaggcgg tgccattttg       480
     cttttgccgt tcgcaacgtg gcatacaatt tttcacgtct taatgatcat cggattttta       540
     ctagttcttc tgattgcatt gaggttaaaa gaaacgcttc cgctggaaaa acggattcca       600
     agctcaatcg gaacatccgt caaaacgatg ggcagcctgc tgaaggatcg atcctttatg       660
     gggtacgcgt taactgtcgg atttattcac gggggaagct ttgcatatgt gtctggtacg       720
     ccttttgtat accaggatat ctacggggtg tctccgcagg tatttagtat tctttttggc       780
     attaacgggc tggcgattat atcgggcagc tttatcatcg gacgctttgg cggaatcatt       840
     catgaaaaaa gcctgcttcg tatagcggtc attacggcta tgattgcgac ggctgtgcta       900
     ttaaccatga ccatgattca cggtcctctt gctacattag tcatatccat tttcatttac       960
     atgattacga tcggcatggt tctgaccagc acgtttaccc tagccatgga aaagcagggg      1020
     caccgcgccg gaagtgcaag tgcgctgctt ggaatgcttc cgctgctcct cggttcaatc      1080
     gtgtcaccgc ttgtaggcat taatgagaca acagccgttc cgatgggagc catcatgttt      1140
     gtgacagctg tcatcggctc actggcgttt tttggattaa cgaaagaacg agtagggcag      1200
     aattcataa                                                              1209
//

If you have problems or comments...

PBIL Back to PBIL home page