(data stored in ACNUC7820 zone)

EMBL: AB065604.PE1

AB065604.PE1         Location/Qualifiers
FT   CDS_pept        join(201..1088,2478..2669)
FT                   /codon_start=1
FT                   /product="seven transmembrane helix receptor"
FT                   /db_xref="GOA:Q8NH09"
FT                   /db_xref="H-InvDB:HIT000383271.8"
FT                   /db_xref="HGNC:HGNC:19628"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8NH09"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAC05832.1"
FT                   /translation="MALGNHSTITEFLLLGLSADPNIRALLFVLFLGIYLLTIMENLML
FT                   LLVIRADSCLHKPMYFFLSHLSFVDLCFSSVIVPKMLENLLSQRKTISVEGCLAQVFFV
FT                   FVTAGTEACLLSGMAYDRHAAIRRPLLYGQIMGKQLYMHLVWGSWGLGFLDALINVLLA
FT                   VNMVFCEAKIIHHYSYEMPSLLPLSCSDISRSLIVLLCSTLLHGLGNFLLVFLSYTRII
FT                   STILSISSTSGRSKAFSTCSAHLTAVTLYYGSGLLRHLMPNSGSPIELIFSVQYTVVTP
FT                   MLNSLIYSLKNKEVKGERSLRDSSHLPQLHKGQARWKRPAFTEGRREPGHPELSIPVTP
FT                   QPQGACACSALRAAPTALP"
     atggccttgg ggaatcacag caccatcacc gagttcctcc tccttgggct gtctgccgac        60
     cccaacatcc gggctctgct ctttgtgctg ttcctgggga tttacctcct gaccataatg       120
     gaaaacctga tgctgctgct cgtgatcagg gctgattctt gtctccataa gcccatgtat       180
     ttcttcctga gtcacctctc ttttgttgat ctctgcttct cttcagtcat tgtgcccaag       240
     atgctggaga acctcctgtc acagaggaaa accatttcag tagagggctg cctggctcag       300
     gtcttctttg tgtttgtcac tgcagggact gaagcctgcc ttctctcagg gatggcctat       360
     gaccgccatg ctgccatccg ccgcccacta ctttatggac agatcatggg taaacagctg       420
     tatatgcacc ttgtgtgggg ctcatgggga ctgggctttc tggacgcact catcaatgtc       480
     ctcctagctg taaacatggt cttttgtgaa gccaaaatca ttcaccacta cagctatgag       540
     atgccatccc tcctccctct gtcctgctct gatatctcca gaagcctcat cgttttgctc       600
     tgctccactc tcctacatgg gctgggaaac ttccttttgg tcttcttatc ctacacccgt       660
     ataatctcta ccatcctaag catcagctct acctcgggca gaagcaaggc cttctccacc       720
     tgctctgccc acctcactgc agtgacactt tactatggct caggtttgct ccgccatctc       780
     atgccaaact caggttcccc catagagttg atcttctctg tgcagtatac tgtagtcact       840
     cccatgctga attccctcat ctatagcctg aaaaataagg aagtgaaggg ggaaagaagc       900
     ctccgggaca gcagtcattt gcctcagctg cacaaaggcc aggccagatg gaagagacca       960
     gccttcaccg aaggccgcag ggagcccgga cacccggagc tgagcattcc ggtcacgcct      1020
     caaccccaag gggcctgcgc atgctccgcg ctgcgcgcgg cgcccacggc cctgccctga      1080
//

If you have problems or comments...

PBIL Back to PBIL home page