(data stored in ACNUC7820 zone)

EMBL: AB065878.PE1

AB065878.PE1         Location/Qualifiers
FT   CDS_pept        201..851
FT                   /codon_start=1
FT                   /product="seven transmembrane helix receptor"
FT                   /db_xref="GOA:Q8NGD7"
FT                   /db_xref="H-InvDB:HIT000383484.8"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="UniProtKB/TrEMBL:Q8NGD7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAC06096.1"
FT                   /translation="MYLVTVLRNLLSILAVSSDSHLHTPMYFFLSNLCWADIGYTSATV
FT                   PKMIVDTQSHGRVISHAGCLTQMSFLVLFACIEDMLLTVMAYDCFVAICCPLHYPVIVN
FT                   PHLCVFFVLVSFFLSLLDSQLHSWIVLQFTIIKNVEISNFVCDPSQLLKLACSDSVINS
FT                   IFIYFDSTMFGFLPISGILLSYSKIVPSVLRMSSSDGKYKAFSTCGSHLAVVC"
     atgtatctgg tcacggtgct gaggaacctg ctcagcatcc tggctgtcag ctctgactcc        60
     cacctccaca cccccatgta cttcttcctc tccaacctgt gctgggctga catcggttac       120
     acctcggcca cggttcccaa gatgattgtg gacacgcagt cgcatggcag agtcatctct       180
     catgctggct gcctgacaca gatgtctttc ttggtccttt ttgcatgtat agaagacatg       240
     ctcctgactg tgatggccta tgactgcttt gtagccatct gttgccctct gcactaccca       300
     gtcatcgtga atcctcacct ctgtgtcttc ttcgttttgg tgtccttttt ccttagcctg       360
     ttggattccc agctgcacag ttggattgtg ttacaattca ccatcatcaa gaatgtggaa       420
     atctctaatt ttgtctgtga cccctctcaa cttctcaaac ttgcctgttc tgacagcgtc       480
     atcaatagca tattcatata ttttgatagt actatgtttg gttttcttcc catttcaggg       540
     atccttttgt cttactctaa aattgtcccc tccgttctaa ggatgtcatc gtcagatggg       600
     aagtataaag ccttctccac ctgtggctct cacctagcag ttgtttgctg a                651
//

If you have problems or comments...

PBIL Back to PBIL home page