(data stored in ACNUC17492 zone)

EMBL: AB380351.RGS18

AB380351.RGS18       Location/Qualifiers
FT   CDS_pept        <1..143
FT                   /codon_start=3
FT                   /transl_table=1
FT                   /gene="RGS18"
FT                   /product="regulator of G-protein signaling 18"
FT                   /db_xref="GOA:B6EYN8"
FT                   /db_xref="InterPro:IPR024066"
FT                   /db_xref="InterPro:IPR034950"
FT                   /db_xref="UniProtKB/TrEMBL:B6EYN8"
FT                   /protein_id="BAG81255.1"
FT                   /translation="TRFLKSDIYLDLIEGRPQRPTNLRRRSRSFTCNEFQDVQSDVAIW
FT                   L"
     atacacgttt tctgaaatct gacatctatt tagacttgat tgaaggaaga cctcagagac        60
     caacaaatct taggagacga tcacgctcat ttacctgcaa tgaattccaa gatgtacaat       120
     cagatgttgc catttggtta taa                                               143
//

If you have problems or comments...

PBIL Back to PBIL home page