(data stored in ACNUC13479 zone)

EMBL: AC005724.PE10

AC005724.PE10        Location/Qualifiers
FT   CDS_pept        complement(join(34793..35362,35448..35666,35752..35979,
FT                   36063..36165,36242..36410,36509..36617))
FT                   /codon_start=1
FT                   /gene="At2g18720"
FT                   /product="putative translation initiation factor eIF-2B
FT                   gamma subunit"
FT                   /db_xref="GOA:Q9ZV47"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR015256"
FT                   /db_xref="InterPro:IPR019756"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9ZV47"
FT                   /protein_id="AAD08941.1"
FT                   /translation="MSKNKGLAEQDLSKLDVAQLHPLSPEVISRQATINIGTIGHVAHG
FT                   KSTIVKAVSGVHTVKFKSELERNITIKLGYANAKIYKCEKCPRPVAYKSFGSGKEDNPS
FT                   CDVSGHEKYKMKLLRHVSFVDCPGHDILMATMLNGAAIMDGALLIIAANETCPQPQTAE
FT                   HLASVDMMHLKDIIIIQNKIDLIQENEAIKQHEDIQRFITNTNAEGAPIVPVSAQLKYN
FT                   IDVLCEYIVKKIPLPVRDFVSPPRMIVIRSFDVNKPGSDYDGMKGGVAGGSILQGVLKV
FT                   GHIIEIRPGITRKDENGDTKCTPIYTRITSLYAEQNELQFAVPGGLIGIGTSMDPTLTR
FT                   GDRLVGQVLGEIGTLPDVYVELEVSFQLLTRLIGVKTKETERQMRVSKLVKGEILMLNI
FT                   GSMSTGAMVIGVKKDMVKVNLTLPVCTSIGEKVAISRRVDRHWRLIGRGQIEAGTTIFI
FT                   PSPPSLA"
     atgtcgaaga acaagggctt agctgaacaa gatctaagta aacttgatgt agctcagctg        60
     catcctctct ctcctgaggt catctctcgt caagccacca ttaacatagg aaccattggc       120
     catgtcgctc acgggaaatc gacaatcgtg aaagccgttt ccggtgtgca cactgtcaaa       180
     ttcaagagtg aattggagcg taacattacc attaaacttg gttacgcaaa cgcaaagatt       240
     tacaaatgtg aaaaatgccc tagaccagta gcctacaagt ctttcgggag tggcaaagaa       300
     gacaacccaa gttgtgatgt ctctggacat gagaagtaca agatgaaact actaagacat       360
     gtctcatttg ttgattgccc gggacacgat atcctaatgg cgacaatgct gaatggagca       420
     gcgattatgg atggtgcttt actaatcatt gctgcgaatg agacatgtcc acaaccacaa       480
     acagctgaac atcttgcttc tgttgatatg atgcatctta aagatatcat aatcattcag       540
     aacaagattg atctcatcca agaaaacgag gctattaaac agcacgagga catccagaga       600
     tttataacga acacgaatgc ggaaggtgct cctatagttc ctgtctcagc gcaactgaaa       660
     tacaacatcg atgttttgtg tgagtacatt gtcaagaaga ttccactccc tgtgagggat       720
     tttgtgtcac ctccaagaat gattgtgatt cgttcttttg atgtcaataa acctggctct       780
     gattatgatg gtatgaaagg tggagttgca ggtgggagta tccttcaggg tgttttgaag       840
     gtggggcata taatagagat aagacctgga atcactagaa aagatgagaa tggagacact       900
     aaatgcactc ccatttacac gcgtataact tcattgtacg cggaacagaa cgagcttcag       960
     tttgctgtcc cgggaggttt gattggaatt gggacaagca tggatcctac gcttacgcgt      1020
     ggtgataggt tagttggtca agtccttggt gaaataggta ctctccctga tgtctatgtt      1080
     gaacttgaag tgagtttcca gcttctgaca cgtctcattg gagtgaagac aaaggaaaca      1140
     gagaggcaaa tgagagtgtc aaagctagtc aagggagaga tactgatgtt gaatatcgga      1200
     tcgatgtcta cgggagctat ggttattgga gtaaagaaag atatggtgaa agttaatctg      1260
     acactccctg tgtgcaccag cattggagag aaagtggcta taagtcgccg tgtggatagg      1320
     cattggcgtt tgatcggtcg cggtcagatt gaggctggaa ccaccatttt tatcccttct      1380
     cctccttctt tggcatga                                                    1398
//

If you have problems or comments...

PBIL Back to PBIL home page