(data stored in ACNUC13479 zone)

EMBL: AC005724.PE11

AC005724.PE11        Location/Qualifiers
FT   CDS_pept        join(38849..39292,39743..39880,39964..40049,40140..40227,
FT                   40334..40409,40497..40579,40700..40770,40876..40953,
FT                   41041..41128,41209..41325,41404..41562)
FT                   /codon_start=1
FT                   /gene="At2g18730"
FT                   /product="putative diacylglycerol kinase"
FT                   /db_xref="GOA:Q8VZG1"
FT                   /db_xref="InterPro:IPR000756"
FT                   /db_xref="InterPro:IPR001206"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR016961"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="InterPro:IPR037607"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8VZG1"
FT                   /protein_id="AAD08942.1"
FT                   /translation="MDSPVSKTDASKEKFVASRPSTADSKTMRGCGLANLAWVGVDKVE
FT                   LRQRLMMPEYLRLAMRDCIKRKDSSAIPDHLLLPGGAVADMAPHAPMVVFINPNSGGRH
FT                   GPVLKERLQQLMSEEQVLLSLNLYFKSFSLGFWGNFESNLYLLCVAGGDGTVGWVLGCL
FT                   GELNKDGKSQIPPVGVIPLGTGNDLSRSFGWGGSFPFAWRSAVKRTLHRASMGPVARLD
FT                   SWKILVSMPSGEVVDPPYSLKPAEENELDQGLDAGIDAPPLAKAYEGVFYNYLSIGMDA
FT                   QVAYGFHHLRNTKPYLAQGPISNKIIYSSFGCSQGWFCTPCVNDPGLRGLRNIMKIHIK
FT                   KVNCSQWEEIAVPKNVRSIVALNLHSYGSGSHPWGNLKPDYLEKRGFVEAHCDDGLIEI
FT                   FGFKQGWHASFVMAELISAKHIAQAAAVRFELRGGDWRDAFLQMDGEPWKQPMSTEYST
FT                   FVEIKKVPYQSLMINNE"
     atggactctc cggtatcaaa aaccgatgca tcgaaagaga aattcgtggc ttcacgacca        60
     tcaacggctg attcaaagac gatgagaggt tgtggactcg cgaatctggc atgggttggt       120
     gtagataaag tagagcttcg tcagaggttg atgatgcctg agtatcttcg tctcgctatg       180
     cgtgactgta tcaaacgcaa agattcctcg gctattcctg atcatttact tcttcctggt       240
     ggtgctgttg ctgatatggc tcctcatgct cctatggttg ttttcattaa ccccaattct       300
     ggtggtcgtc atggtcctgt tcttaaagag aggcttcaac agttgatgag cgaggaacag       360
     gttttgctct cactgaactt gtatttcaaa tctttttctt tgggtttttg ggggaatttc       420
     gaatctaatt tgtatctact ttgtgttgca ggaggtgatg gtactgttgg ttgggttctt       480
     ggatgtcttg gagagcttaa taaagatgga aagtcgcaaa ttcctcctgt tggagttatt       540
     cctctcggta cagggaatga tctttcaagg agttttggtt ggggtggttc gtttcctttt       600
     gcgtggagat ctgctgttaa aagaacactc catcgcgcaa gtatgggtcc agttgctaga       660
     cttgacagct ggaagatttt agtgtcaatg ccatctggag aagtcgtaga tcctccttat       720
     tctttaaaac ccgctgaaga aaacgaactt gatcagggtt tggacgcggg aattgatgcg       780
     cctccacttg caaaggctta tgaaggtgtt ttctacaatt acttaagcat aggtatggat       840
     gctcaagttg catatggctt ccaccatctt cgcaacacta aaccatatct tgctcaaggc       900
     cctatttcaa ataagattat atattcaagt tttggttgca gtcagggttg gttttgcacg       960
     ccttgtgtca acgatccagg tttaagggga cttaggaaca taatgaaaat tcacatcaaa      1020
     aaggttaact gctctcagtg ggaagagatc gcagtcccga aaaatgtgag atcaattgtc      1080
     gcattgaatc ttcacagcta tggaagtgga agccatcctt ggggcaatct aaaaccggac      1140
     tatctagaga agagaggctt tgtggaagca cattgtgatg atggtttgat agagattttc      1200
     ggttttaagc aaggatggca cgcgtcattt gtcatggctg agctcatctc tgccaagcac      1260
     atagctcagg ctgctgcggt aagatttgag ctaagaggag gtgactggag agacgcattc      1320
     ttgcaaatgg atggtgagcc atggaagcaa ccaatgagca ctgagtactc aacatttgtg      1380
     gagatcaaga aggttcctta tcaatctctg atgataaata atgaatga                   1428
//

If you have problems or comments...

PBIL Back to PBIL home page