(data stored in ACNUC13479 zone)

EMBL: AC005724.PE13

AC005724.PE13        Location/Qualifiers
FT   CDS_pept        join(45700..45815,45966..46041,46132..46190,46271..46764,
FT                   46850..47166)
FT                   /codon_start=1
FT                   /gene="At2g18750"
FT                   /product="putative calmodulin-binding protein"
FT                   /db_xref="GOA:C0SV51"
FT                   /db_xref="InterPro:IPR012416"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0SV51"
FT                   /protein_id="AAD08944.2"
FT                   /translation="MQTRYMERTNSMREKRKLEEDDNQQQQQQPERKRPALASVIVEAL
FT                   KMDSLQRLCSSLEPILRRVVSEEVERALAKLGPARLSERSSPKRIEGIGGRNLQLQFRS
FT                   RLSVPLFTGGKIEGEQGAAIHVVLLDMTTGHVLTVGPEASAKLDVVVLDGDFNTEDDDG
FT                   WSGEEFEGHLVKERQGKRPLLTGDVQVTLKEGVGTLGELIFTDNSSWIRCRKFRLGLRV
FT                   SSGYCEGMRVREAKTEAFTVKDHRGELYKKHYPPALDDEVWRLEKIGKDGAFHKKLNKA
FT                   GIYNVKEFLRLMVKDSQKLRTVSARFNYPVSYQDVQILLFIMMTLTLIFRFLEVACQTG
FT                   CGRHLQSIPRHVY"
     atgcagacga ggtatatgga gaggactaat agtatgagag agaagagaaa attggaggaa        60
     gatgataatc agcagcagca gcaacagcct gagcgtaaaa ggccagctct tgcaagtgta       120
     attgtggaag ccttgaagat ggatagttta cagaggcttt gttcttcttt ggaaccgatt       180
     cttcgccgag tggtaagtga agaggtggag cgggcattgg caaagcttgg ccctgcaaga       240
     cttagtgaaa ggtcgtctcc aaaacgaatt gaaggtatcg gtggaaggaa tttgcagcta       300
     caattcaggt ctagattgtc tgttcctttg tttactggag ggaagataga aggggagcaa       360
     ggtgctgcaa tccatgttgt actgttggat atgacaactg gacatgtttt gacagtagga       420
     cctgaagctt ctgcaaagct tgatgttgtt gtgcttgatg gtgattttaa cactgaagat       480
     gatgatggtt ggagtggaga agagtttgag ggtcatttgg tgaaagaacg tcaagggaag       540
     aggcctctct tgactggtga tgtgcaggtc acgttgaaag aaggtgtggg aacattaggg       600
     gaacttatct ttacggacaa ctcaagttgg attagatgca gaaaattcag gctgggttta       660
     agggtctctt cgggttactg tgagggaatg cgtgtacgcg aggcaaaaac agaagctttt       720
     accgtgaagg accatcgtgg agagttgtac aagaaacatt acccacctgc tttggatgat       780
     gaggtctgga ggttggaaaa gattggaaag gacggggctt tccataagaa actcaataaa       840
     gcaggaatct acaatgttaa agaattcctg cgtcttatgg tcaaagactc tcagaaacta       900
     aggactgtga gtgcacgatt taactatcca gtatcttacc aagatgttca aatattatta       960
     ttcatcatga tgactcttac tctgattttc agattcttgg aagtggcatg tcaaacagga      1020
     tgtgggagac acttgcagag cattccaaga catgtgtatt ga                         1062
//

If you have problems or comments...

PBIL Back to PBIL home page