(data stored in ACNUC13479 zone)

EMBL: AC005724.PE14

AC005724.PE14        Location/Qualifiers
FT   CDS_pept        join(49027..49116,49228..49749,49880..50282,50562..51429,
FT                   51511..52120,52210..52647,52743..53375)
FT                   /codon_start=1
FT                   /gene="At2g18760"
FT                   /product="putative SNF2/RAD54 family DNA repair and
FT                   recombination protein"
FT                   /db_xref="GOA:Q9ZV43"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9ZV43"
FT                   /protein_id="AAD08945.1"
FT                   /translation="MEEDEDQFLLSSLGVTSANPEDLEQKILDEATKKPDNDEGGSVEE
FT                   KSTQLEGTNLLSSSQNELLNKLRAVKFEIDAVASTVENVDEIAAEKGLKKDDESDLQGL
FT                   HSGSALQHALATDRLRSLKKRKIQLEKELTGLHGQSASSSADHGNLLRDLVKEKPSLKR
FT                   KLKEIRKPSRRDGKKVKVVSFREDTDFDAVFDGASAGFVETERDELVRKGILTPFHKLD
FT                   GFERRLQQPGPSNSRNLPEGDDENEDSSIIDRAVQSMSLAAKARPTTKLLDAEDLPKLE
FT                   PPTAPFRRLRKLYKTPNSPDNEAKKRKAGKKSKKTRPLPEKKWRKRISREDSSLQGSGD
FT                   GRRILTTSSCEEEELDDFDDADDNERSSVQLEGGLNIPECIFRKLFDYQRVGVQWLWEL
FT                   HCQRAGGIIGDEMGLGKTIQVLSFLGSLHFSKMYKPSIIICPVTLLRQWRREAQKWYPD
FT                   FHVEILHDSAQDSGHGKGQGKASESDYDSESSVDSDHEPKSKNTKKWDSLLNRVLNSES
FT                   GLLITTYEQLRLQGEKLLNIEWGYAVLDEGHRIRNPNSDITLVCKQLQTVHRIIMTGAP
FT                   IQNKLTELWSLFDFVFPGKLGVLPVFEAEFSVPITVGGYANASPLQVSTAYRCAVVLRD
FT                   LIMPYLLRRMKADVNAHLTKKTEHVLFCSLTVEQRSTYRAFLASSEVEQIFDGNRNSLY
FT                   GIDVMRKICNHPDLLEREHSHQNPDYGNPERSGKMKVVAEVLKVWKQQGHRVLLFSQTQ
FT                   QMLDILESFLVANEYSYRRMDGLTPVKQRMALIDEFNNSEDMFVFVLTTKVGGLGTNLT
FT                   GANRVIIFDPDWNPSNDMQARERAWRIGQKKDVTVYRLITRGTIEEKVYHRQIYKHFLT
FT                   NKILKNPQQRRFFKARDMKDLFILKDDGDSNASTETSNIFSQLAEEINIVGVQSDKKPE
FT                   SDTQLALHKTAEGSSEQTDVEMTDKTGEAMDEETNILKSLFDAHGIHSAVNHDAIMNAN
FT                   DEEEKMRLEHQASQVAQRAAEALRQSRMLRSRESISVPTWTGRSGCAGAPSSVRRRFGS
FT                   TVNSRLTQTGDKPSAIKNGISAGLSSGKAPSSAELLNRIRGSREQAIGVGLEQPQSSFP
FT                   SSSGSSSRVGSLQPEVLIRKICSFVQQKGGSADTTSIVNHFRDIVSFNDKQLFKNLLKE
FT                   IATLEKDQNRSFWVLKSEYKD"
     atggaggaag acgaggatca gtttttgttg agtagcttag gtgtgacatc ggccaatcct        60
     gaagatctag aacagaagat actcgatgag gcgacgaaga aaccagacaa cgatgagggt       120
     gggagtgtgg aggagaagtc tacacagctt gaaggaacca atctgctttc atctagccaa       180
     aacgagcttt tgaataaatt gagggctgta aagtttgaaa tagatgctgt tgcatcaact       240
     gttgagaacg tcgacgagat tgcagcagaa aagggcttaa agaaagatga tgaatcagat       300
     ttacaagggt tgcatagtgg ttctgctctt cagcatgccc ttgccacaga ccggctaaga       360
     agtcttaaga agagaaaaat tcaacttgaa aaggaactta ctggtcttca tggtcagagt       420
     gcgtctagta gtgctgatca cggtaatcta ctgcgagatt tggtgaagga gaagcctagt       480
     cttaagagaa aattgaaaga gattcggaaa ccaagcagaa gagatgggaa gaaggtgaaa       540
     gtagtctcct ttcgtgagga cacagatttt gatgctgttt ttgatggagc ttcagctggt       600
     tttgttgaaa cggaaagaga tgaactggtg agaaaaggaa ttttaactcc atttcacaag       660
     ctcgatggtt ttgaacgccg acttcaacaa cctggaccgt caaactcacg caacctacct       720
     gaaggagacg acgaaaatga ggactccagc attattgata gagctgtcca atctatgtcg       780
     ctggctgcaa aggctcgtcc cacaaccaag ctacttgatg cagaagactt gccaaagctt       840
     gaaccgccca ctgctccttt tagaaggctg agaaagcttt acaagactcc taattctccg       900
     gataatgaag caaagaaacg taaagctggg aagaagagca aaaagacgcg gcctttgcct       960
     gaaaagaaat ggagaaagcg aatctctcgt gaagactcta gtcttcaagg aagtggagat      1020
     ggaaggagaa tcttgaccac ttccagttgc gaggaagaag agctagatga ttttgatgat      1080
     gcagatgaca acgaaagatc ttctgtacag cttgaaggtg gattaaacat tcctgaatgc      1140
     atctttcgta aactttttga ctaccaaaga gttggggtgc aatggctttg ggaacttcat      1200
     tgccaaaggg ctggtggcat tatcggggac gagatgggtc ttggtaaaac tatacaggtc      1260
     ttatcttttc tcggatcctt gcatttcagt aagatgtaca aaccgagtat tatcatatgt      1320
     cctgttacac tcttgcgtca atggagaaga gaagcacaga aatggtaccc agattttcac      1380
     gtggaaatac tccatgactc agcacaagat tctgggcacg gcaaaggtca aggcaaggcc      1440
     tctgaaagtg attacgacag tgagagttcc gttgatagtg atcatgagcc aaagtctaag      1500
     aacaccaaga agtgggattc tttgttaaac cgggttctaa attctgagtc agggctcctc      1560
     atcaccacat atgagcaatt gaggttgcag ggtgagaagc tgctcaatat tgagtggggt      1620
     tatgcagtac tggacgaagg ccatcggatc cggaacccaa attctgacat tactttggtg      1680
     tgcaaacagt tacagaccgt ccatcgaatt attatgactg gggcaccaat ccagaataaa      1740
     ctaacagaac tctggtcctt gttcgatttt gttttcccgg gaaaactggg ggtcctgcct      1800
     gtgtttgagg cagaattttc tgttcccata actgtgggtg gttatgccaa tgcttctcct      1860
     ttacaagtgt cgactgccta taggtgtgct gttgttctcc gtgatttgat tatgccgtac      1920
     ctcctccgcc gtatgaaggc cgatgtaaac gcacatctta caaaaaagac tgaacacgtt      1980
     ctcttttgca gtctcactgt ggagcagcga tctacctaca gggcattcct tgcaagctcc      2040
     gaagtagaac agatttttga tggcaacagg aattcgcttt atgggattga tgtgatgcgt      2100
     aagatatgca accaccctga tctacttgag agagaacatt ctcaccagaa cccagattat      2160
     ggaaacccag aacgcagtgg gaagatgaag gttgttgcag aagtgctcaa ggtctggaaa      2220
     cagcaaggac accgtgtact tctgttttca cagactcagc aaatgcttga catcctcgag      2280
     agcttcttgg ttgcaaatga gtatagttac cggaggatgg atggtcttac tccagtgaaa      2340
     cagagaatgg ctttaattga tgagtttaat aattcagaag acatgtttgt tttcgttctg      2400
     acgacgaagg ttggtggttt gggaacaaat ttgactggtg cgaacagggt cattatcttt      2460
     gacccggatt ggaacccctc aaatgatatg caggcaaggg aacgtgcatg gcgtattggg      2520
     cagaagaagg atgttaccgt ttacagattg atcactcgtg gcacaattga ggagaaggta      2580
     tatcatagac agatttataa acattttctc accaataaga tcttgaagaa tccacaacag      2640
     agaagattct tcaaagctcg ggatatgaaa gatcttttca tcctgaaaga tgatggcgat      2700
     agcaacgcct ccacggaaac ctctaacatc ttcagtcagc tggcggaaga gataaacatc      2760
     gtaggagttc aatcagataa aaaacctgaa tccgatacac aacttgctct tcacaaaact      2820
     gcagagggat cctcagagca aacagatgtg gaaatgactg ataaaactgg tgaagccatg      2880
     gatgaagaga caaatatctt aaagagtctc tttgatgcgc atggaataca tagtgctgtg      2940
     aatcacgacg ccataatgaa tgcaaacgac gaggaagaga agatgagact tgaacaccaa      3000
     gcatctcaag tggcacaaag agctgcggaa gcattgcgcc aatcacgaat gctgcgtagc      3060
     cgcgaaagca tctcagtgcc tacatggacg ggaagatctg gttgtgcagg tgcaccatca      3120
     tctgtacgga ggagatttgg atcaactgtc aattcccggt taacccagac tggagacaaa      3180
     ccatcagcga ttaagaatgg aatcagtgcg ggtctatctt caggcaaagc accatcttcc      3240
     gcagagcttc tcaacagaat ccgcggaagc agagaacaag ccattggcgt tgggcttgag      3300
     cagccacagt cttcattccc ttcttcttcg ggttcaagca gcagagtagg ttcgttgcag      3360
     cccgaggtcc tgatccgaaa gatatgcagc tttgtacagc aaaaaggtgg aagtgcagac      3420
     acgaccagca tcgtcaacca tttcagggac atagtttctt ttaatgacaa gcagttgttt      3480
     aagaatctct tgaaagagat tgccacgctt gagaaggatc aaaatagatc gttttgggtc      3540
     ctcaaatcag agtataaaga ctaa                                             3564
//

If you have problems or comments...

PBIL Back to PBIL home page