(data stored in ACNUC13479 zone)

EMBL: AC005724.PE15

AC005724.PE15        Location/Qualifiers
FT   CDS_pept        join(54857..54995,55165..55247,55403..55492,55577..55725,
FT                   55817..55948,56044..56233)
FT                   /codon_start=1
FT                   /gene="At2g18770"
FT                   /product="putative signal recognition particle receptor
FT                   beta subunit"
FT                   /db_xref="GOA:Q9ZV42"
FT                   /db_xref="InterPro:IPR019009"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9ZV42"
FT                   /protein_id="AAD08946.1"
FT                   /translation="MDNLEDLKIVAEQWSKQGLEFVQKIPPPQLYTAIGVLLLATIWLL
FT                   SIRLFRRTKSNTVLLSGLSGSGKTVLFYQLRDGSSHQGAVTSMEPNEGTFVLHNENNTK
FT                   KGKVKPVHLIDVPGHSRLISKLEEYLPRAAAVVFVVDALEFLPNIRAASEYLYDILTNA
FT                   SVIKNKTPVLLCCNKTDKVTAHTKEFIRKQMEKEIDKLRVSRSAISTADIANDFTLGIE
FT                   GEVFSFSHCHNKVTVAEASGLTGETDQVQEFIREHVKP"
     atggacaact tggaagattt gaagattgtg gcagagcagt ggtctaaaca aggacttgaa        60
     tttgttcaaa aaataccacc acctcagctt tatactgcca ttggtgttct cttattagct       120
     accatttggc tcttatctat tcgtttgttt agacgtacaa aatccaatac tgtactcctc       180
     tctgggctaa gtggaagtgg caaaacagtt ctcttctatc aactacgaga tggatcttcc       240
     catcagggtg ctgtaacgtc aatggaaccg aacgaaggca cctttgtgct tcacaatgaa       300
     aacaacacta agaaaggaaa agtaaagcct gttcatctta ttgatgttcc tggacactct       360
     cggcttatat ctaagctaga agaatacttg cctcgagccg ccgctgttgt gtttgtagta       420
     gatgcattgg agttcctccc aaatatccgg gcagcttcag agtaccttta cgacattctg       480
     accaatgcta gcgttattaa gaataagacc ccggttctgc tttgctgtaa caagacagat       540
     aaagtaactg cacacaccaa agagttcatc cgcaagcaga tggagaaaga aatagataaa       600
     cttagggttt cgaggagcgc aatatcaaca gctgatatag cgaatgactt cactcttggg       660
     attgaaggag aagtgttttc cttttcgcat tgccataaca aagtcacggt cgctgaggcg       720
     tctggactaa caggagaaac agatcaggta caagagttca tcagagaaca cgtaaagcca       780
     tga                                                                     783
//

If you have problems or comments...

PBIL Back to PBIL home page