(data stored in ACNUC13479 zone)

EMBL: AC005724.PE16

AC005724.PE16        Location/Qualifiers
FT   CDS_pept        complement(56856..57947)
FT                   /codon_start=1
FT                   /gene="At2g18780"
FT                   /product="expressed protein"
FT                   /db_xref="GOA:Q84V15"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR006527"
FT                   /db_xref="InterPro:IPR011043"
FT                   /db_xref="InterPro:IPR017451"
FT                   /db_xref="InterPro:IPR036047"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q84V15"
FT                   /protein_id="AAD08947.1"
FT                   /translation="MLSDLPKDVAEEVLSKFPVTSLRRVRFTCKKLNTLSKDMSFTRKH
FT                   IDKEEAKKKQSKEFHVVMMLDFRVSLFSLNLLNPNPIERLGQLVSLDGGAQVDISNIFH
FT                   CEGFLLCTTKDISRVVVWNPCVGQTIWIKPRNSFNKWDRYALGYDVMKNHKVLRFVDDG
FT                   EYGRRHLLCEFEIYSFESDSWEVLDVNPDWEIDFVHRGLSIDGNSYWFARDKVVPYGGQ
FT                   DPSYFLLCFDFTTERFRPPLPLPFQPYFGDTVALSSVGDNQIAVLCQRSSSPYTLKIWI
FT                   SSKVEPNAVSWNKLFLKVDMKPLTGNSFSYSGGSFFVDEEKKMAVVLDKNIGGGFDPTR
FT                   NIAYIIGKEGYFKKVDLGESRHL"
     atgctctcgg atcttccaaa ggatgtggcg gaggaggtgc tctcgaagtt tccagtgaca        60
     tctctgagaa gagtacgatt cacatgcaaa aagttgaaca ctttatccaa agatatgtct       120
     tttacaagga agcacatcga taaagaagaa gcaaagaaga agcagagtaa ggagtttcat       180
     gttgtgatga tgctcgattt tagggtttct ttattcagtc tcaatctact aaaccctaat       240
     cccatagagc gtttaggtca acttgttagc ttagacggtg gtgcacaagt cgacatatct       300
     aacatttttc actgcgaggg tttcttgtta tgcaccacta aagacatatc tagggttgtt       360
     gtttggaacc cttgtgttgg gcaaacaatt tggatcaaac ccagaaactc tttcaacaaa       420
     tgggataggt atgctctggg ctacgatgtg atgaagaatc ataaagtttt gagatttgtg       480
     gatgacggtg agtatggaag gagacactta ctttgtgagt ttgaaatcta cagttttgag       540
     tctgattcat gggaggttct tgatgtgaat ccggattggg agatagattt tgttcaccgt       600
     ggtttgtcta tcgatggaaa cagttactgg tttgcacgag acaaggttgt tccatatgga       660
     ggacaagatc cttcttattt cttgctgtgt tttgatttca caacggagag atttagaccg       720
     cctctgcctc tgccatttca gccttacttt ggtgatactg tggctctatc tagcgttggg       780
     gataaccaga ttgcggtctt gtgtcagcgg tcttcttcgc cgtatacctt gaagatatgg       840
     attagcagca aggttgagcc caatgcagtg tcgtggaaca agttgttctt aaaggttgac       900
     atgaaacctc tcactggtaa ttccttctct tattcgggtg ggagtttctt tgttgacgag       960
     gagaagaaga tggctgtggt tcttgataaa aacataggtg gtggatttga cccgactcgc      1020
     aacatagctt acatcattgg aaaggagggc tacttcaaga aagttgatct tggcgaatct      1080
     aggcacctct ag                                                          1092
//

If you have problems or comments...

PBIL Back to PBIL home page