(data stored in ACNUC13479 zone)

EMBL: AC005724.PE19

AC005724.PE19        Location/Qualifiers
FT   CDS_pept        complement(join(67812..68249,69076..69342))
FT                   /codon_start=1
FT                   /gene="At2g18810"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:Q9ZV39"
FT                   /db_xref="InterPro:IPR003340"
FT                   /db_xref="InterPro:IPR005508"
FT                   /db_xref="InterPro:IPR015300"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9ZV39"
FT                   /protein_id="AAD08950.1"
FT                   /translation="MVRAFAYEEIGETSTEAHASVEDNKRDRTRRVINYNLRSTTMISS
FT                   LSKRLKIDECKNQDPEQNPNRVASSPSLCHVKSKRPQKGVSNKPILDMDFLNEEELEKI
FT                   DRHYKKISDSDKGADVILVNSEGLQRKLKLKRWDMTSTSNYVLGSGWNKVVTENILETG
FT                   TRLRLWSFHSPDMLFFALVLSDPDLAPTKDWECLNLLAKLTVETACLEASQDADTMSSL
FT                   VSDTELDLELRL"
     atggttagag cttttgcata tgaggaaata ggagaaacat ccactgaagc tcatgctagt        60
     gtcgaggata ataagagaga tagaacgaga agagtaatta attacaatct aaggagcaca       120
     acgatgattt ccagcttgag caaacgattg aagattgatg agtgcaagaa tcaagacccg       180
     gaacaaaacc ctaatcgtgt tgcttcttct ccaagtttgt gccatgtaaa gtccaagagg       240
     cctcaaaaag gggtttcaaa caaaccaata ctagatatgg acttcttaaa cgaggaagag       300
     ttagaaaaaa tagatagaca ttacaaaaag ataagtgaca gtgacaaagg agcggatgtg       360
     atcttggtga attccgaggg tctacagagg aagcttaagc tcaagagatg ggatatgact       420
     tccacttcca actacgtctt aggttcagga tggaacaagg tcgtcaccga aaacattcta       480
     gagacaggca cgaggcttcg gctctggtcc ttccactccc cagacatgct ctttttcgcc       540
     ctcgttcttt cagatccaga tctagctccg actaaagatt gggagtgcct aaatttattg       600
     gctaaattga ccgtggagac ggcttgtctc gaggcttcac aagacgcaga tacgatgagc       660
     tcactcgtct ccgacacaga gctggatctc gagctccggt tgtag                       705
//

If you have problems or comments...

PBIL Back to PBIL home page