(data stored in ACNUC13479 zone)

EMBL: AC005724.PE21

AC005724.PE21        Location/Qualifiers
FT   CDS_pept        complement(76077..76274)
FT                   /codon_start=1
FT                   /gene="At2g18830"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:O64613"
FT                   /db_xref="UniProtKB/TrEMBL:O64613"
FT                   /protein_id="AAD08952.1"
FT                   /translation="MDMLKKRKLDENGIAMLHDGVSGSVSFRLVPQDARKITELFFADQ
FT                   LLDILQEAIVRHPDVLFFFF"
     atggatatgt tgaagaagcg aaagctcgat gaaaatggaa tcgcgatgct acacgatgga        60
     gtcagtggct ctgtttcgtt tcgattggtg ccacaagacg cgaggaagat taccgagctt       120
     ttctttgctg atcagcttct tgatatcttg caagaagcta ttgtacgaca tccagatgtt       180
     cttttttttt ttttttga                                                     198
//

If you have problems or comments...

PBIL Back to PBIL home page