(data stored in ACNUC13479 zone)

EMBL: AC005724.PE22

AC005724.PE22        Location/Qualifiers
FT   CDS_pept        join(78161..78670,79297..79371,79461..79721)
FT                   /codon_start=1
FT                   /gene="At2g18840"
FT                   /product="expressed protein"
FT                   /db_xref="GOA:O64614"
FT                   /db_xref="InterPro:IPR006977"
FT                   /db_xref="UniProtKB/TrEMBL:O64614"
FT                   /protein_id="AAD08953.1"
FT                   /translation="MSQGDTVPLHPSSQSDIDEIENLINESVQSGPGTVLAARPPSPTR
FT                   PSIPVSSSSSSSPFMQSNLPPLHPSSSAQKVTHVPVPPPLPAVSNSSNFQGASAFGSPP
FT                   NTLTEPVWDTVKRDLSRIVSNLKLVVFPNPYREDPGKALRDWDLWGPFFFIVFLGLTLS
FT                   WSASVKKSEVFAVAFALLAAGAVILTLNVLLLGGHIIFFQSLSLLGYCLFPLDVGAVIC
FT                   MLKDNVILKMVVVSVTLAWSSWAAYPFMSSAVNPRRKALALYPVFLMYVSVGFLIIAIN
FT                   "
     atgtcacaag gcgatacagt accgcttcat ccatcgtctc aatcagacat tgacgagatc        60
     gagaatctga ttaacgaaag cgtccaatca ggtcccggaa ccgttctcgc cgctcgtcca       120
     ccgagcccaa ccagaccttc gattccagta tcttcttctt cttcttcttc tccgtttatg       180
     caatcgaatc ttccaccgct tcatccgtcg tcatcagctc agaaagtgac acatgtcccc       240
     gttcctccgc ctcttccggc ggtaagtaac tccagcaatt tccaaggagc gagtgctttt       300
     ggatctccgc ctaatacgtt gacggagcct gtgtgggata ctgtgaagcg agatctgtct       360
     cggatcgtga gtaatttgaa gcttgtggtg tttcctaatc cgtataggga agatcctggg       420
     aaggctctta gagattggga tctttggggt ccgtttttct tcattgtgtt cttgggtctt       480
     actctttcat ggtcagcttc cgtcaagaag tccgaggtat ttgcagtggc atttgcacta       540
     ttagcagccg gggcggtgat ccttacacta aacgtgcttc tcctgggtgg acatataatc       600
     ttcttccaaa gcttgagcct tctaggttac tgtttatttc cgctagacgt tggagccgtg       660
     atctgcatgt tgaaagacaa tgtgatactg aagatggtgg ttgtgtctgt aacccttgcc       720
     tggagctcat gggctgctta cccttttatg agctcagcgg ttaacccaag aagaaaagca       780
     ctcgctctat accccgtctt cctcatgtat gtgtcagtcg gttttctcat catagccatc       840
     aattga                                                                  846
//

If you have problems or comments...

PBIL Back to PBIL home page