(data stored in ACNUC13479 zone)

EMBL: AC005724.PE23

AC005724.PE23        Location/Qualifiers
FT   CDS_pept        join(80798..80863,81054..81182,81252..81543,81626..81744,
FT                   81831..81963,82050..82126,82214..82313,82763..82935,
FT                   83028..83128,83217..83352)
FT                   /codon_start=1
FT                   /gene="At2g18850"
FT                   /product="unknown protein"
FT                   /db_xref="InterPro:IPR036464"
FT                   /db_xref="UniProtKB/TrEMBL:O64615"
FT                   /protein_id="AAD08954.1"
FT                   /translation="MSETGDLCVELPKDDPFYHHKKKFLSCKGLCVKETLNLSGSLSQQ
FT                   LLNAALEKLLHFGRIVNLDKVEVYFGEDACTPAGIYSVRNEISALSWILSLIPVSCKMQ
FT                   TQVDTFEALRAALKGRINEVVGAEKEKARVVDSYRCEKESKLVEWGQDNGVKTKLQIAQ
FT                   IDGYGRGAIASEDLKFGDVALEIPVSSIISEEYVYNSDMYPILETFDGITSETMLLLWT
FT                   MREKHNLDSKFKPYFDSLQENFCTGLSFGVDAIMELDGTLLLDEIMQAKELLRERYDEL
FT                   IPLLSNHREVFPPELYTWEHYLWAYFDVIDDEDIETEFSWTTHMLRGTWLSSNHNIFHY
FT                   GLPTPLLNYLRKAHGLVHHSETDLWKNLEVEIGVLENLQSTFDDMMQNLGDADSIDREN
FT                   ADWDVKLAMEFKERQRKIVSSILDSCSAGIKLVQESITNPPV"
     atgtcagaga ctggtgattt atgtgtagaa cttcccaaag atgatccctt ttatcaccac        60
     aaaaagaagt tcttgagttg caaaggttta tgcgtaaagg aaacattgaa cctcagtgga       120
     tcattatctc aacaactgtt gaatgctgca ttggaaaagt tgcttcattt tggacgaata       180
     gttaatctcg ataaggtgga agtttacttt ggtgaggatg cttgcactcc tgcaggaatt       240
     tacagtgtta gaaacgaaat ctcagctctc agctggatcc tttcgcttat accggtttct       300
     tgtaagatgc aaacacaagt tgataccttt gaagctctac gagctgcttt aaaaggtaga       360
     atcaatgagg ttgttggagc tgaaaaggag aaagctagag ttgttgatag ctatagatgc       420
     gaaaaggaaa gcaaattagt agaatggggt caggacaatg gagtcaaaac caaattgcag       480
     atagctcaaa ttgatggcta tggacgagga gctatagcta gcgaagactt gaaatttggc       540
     gatgttgctt tagagattcc agtctcaagt atcatttcgg aggagtatgt gtacaactcc       600
     gacatgtacc caatattgga gacgtttgat ggcattacat ctgagacaat gctgctctta       660
     tggaccatga gggaaaagca taacctggac tcgaaattca aaccatactt tgactctctg       720
     caagagaatt tttgtaccgg tttgagtttt ggggttgatg caatcatgga gcttgatggt       780
     acattgcttt tagatgaaat aatgcaagct aaagagcttt tgcgtgagag gtatgatgaa       840
     ttgattcctc ttttatcgaa ccaccgggaa gtatttccac cggagctcta tacatgggaa       900
     cattacttat gggcttattt tgatgtcatt gatgatgaag acatcgagac cgagttttct       960
     tggacaactc acatgttacg cgggacttgg ctatcgagta atcacaacat cttccactac      1020
     ggcttgccta ctccattgtt gaactacttg cgcaaagctc atggtcttgt tcatcattct      1080
     gaaacagatt tatggaagaa cttggaagtt gagataggag tacttgagaa tctccaatcc      1140
     acattcgacg acatgatgca aaatcttggc gatgcagatt ctatcgacag agaaaacgcg      1200
     gattgggatg ttaaactagc gatggagttc aaagagcggc agagaaagat tgtctcatcc      1260
     attcttgatt catgttctgc aggtatcaaa ctagttcaag aatccataac taacccaccg      1320
     gtttag                                                                 1326
//

If you have problems or comments...

PBIL Back to PBIL home page