(data stored in ACNUC13479 zone)

EMBL: AC005724.PE24

AC005724.PE24        Location/Qualifiers
FT   CDS_pept        join(84231..84313,84434..84524,84615..85232)
FT                   /codon_start=1
FT                   /gene="At2g18860"
FT                   /product="unknown protein"
FT                   /db_xref="GOA:O64616"
FT                   /db_xref="InterPro:IPR010989"
FT                   /db_xref="InterPro:IPR015260"
FT                   /db_xref="UniProtKB/TrEMBL:O64616"
FT                   /protein_id="AAD08955.1"
FT                   /translation="MMVVNSFDLWQKDVFFSAAEEVQKSTDIMESAYRLWIREKKDEIC
FT                   KELQAALGTAKWQLEEFEKAVRLSHKRCGDNDSSSTRHKQFVTAIENQIHRVETSLQEA
FT                   YSENGKKPLRWVDLNEEERDDLAMFLSGSSRTSQSFSGESSIKSRESTNSSLVENVMEV
FT                   SAKVTFKKAKVYGDGSECVIDIEERVTPGQAEKSVGLRRIWSSPNFNSLRIIVPGGDNE
FT                   EEKETLVAQIEATPKVKGTKSVLWMQRLPDHNQVSVLIYKL"
     atgatggtag tgaacagctt tgatctatgg caaaaagatg ttttcttctc tgcagctgaa        60
     gaggttcaaa aatctacaga tataatggag tctgcttata gattgtggat tagagagaag       120
     aaagatgaga tttgtaagga acttcaagca gctttaggta cagctaaatg gcagttggag       180
     gagtttgaga aggcagtgag attgagtcat aaacggtgtg gggataatga ttcttcatcc       240
     acacggcata aacagtttgt taccgctatt gaaaaccaga ttcatcgcgt agaaacttct       300
     ctgcaagaag cttatagtga aaatgggaaa aagcctctcc gttgggttga tcttaatgaa       360
     gaagagcgtg atgacttagc aatgtttctc tctggatctt ctcgaacttc acagagtttt       420
     agtggtgaga gcagcatcaa gtcgagagag tctactaata gttctctagt tgaaaacgtt       480
     atggaagttt cagctaaagt aacattcaag aaagctaaag tttatggtga tggctctgag       540
     tgtgtcatag acattgaaga aagagtgaca cctggccaag cagagaaatc agttgggctg       600
     agaagaatat ggagttcacc aaatttcaat tctttgagaa ttatagttcc tggtggtgat       660
     aatgaagaag aaaaggagac attggtggca caaatagaag cgacgcctaa agttaaagga       720
     actaagtctg tattgtggat gcagagactt cctgatcata atcaggtgag tgtgttgata       780
     tataagcttt ag                                                           792
//

If you have problems or comments...

PBIL Back to PBIL home page