(data stored in ACNUC13479 zone)

EMBL: AC005724.PE3

AC005724.PE3         Location/Qualifiers
FT   CDS_pept        complement(6733..8004)
FT                   /codon_start=1
FT                   /gene="At2g18650"
FT                   /product="putative RING zinc finger protein"
FT                   /db_xref="GOA:Q9ZV53"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9ZV53"
FT                   /protein_id="AAD08934.1"
FT                   /translation="MNKILPEMKSTQNLISSSPPPPLIPLKSNTSLSNLNSKITPNILL
FT                   IIIILSIIFFISGLLHILVKFLLTPSRESREDYFDNVTALQGQLQQLFNLHDSGVDQSL
FT                   IDTLPVFHYKSIVGLKISPFDCPVCLCEFETEDKLRLLPKCSHAFHVECIDTWLLSHST
FT                   CPLCRSNLLSGFSSHHNLSSSYLLVLESEQSSRDMVPVLESNSQLGYDVNNDSESTRIR
FT                   SGRKSCDPDGDMDGLDEKVVPLEVKLGKFRNIDHVGEGSDQKKNSISGNSKNVDGRRCL
FT                   SMGSYEYIMDQEATLKVHVSTKKLSGKDRVPSHRTVMSECGFDPTVKGIEKSVVERESF
FT                   SLSKIWLRGKKEKQKGTSARDSDCSFVSSSSLRFPNHRIPPEESLKSENSESLETKTPS
FT                   FARRTMHWLAGRQNKIVQPSTSNV"
     atgaacaaga ttttaccgga aatgaaatca actcagaatt tgatctcttc ttcaccacca        60
     ccaccattga tacctctcaa atcaaacaca agcttgtcaa atttaaacag caaaatcact       120
     ccaaatattc ttctaataat cataatcctc tcgatcatct tcttcatctc tggtcttctc       180
     catattcttg tcaaattcct cctcacacca tcaagagaaa gcagagaaga ttacttcgac       240
     aatgttacag ctcttcaagg ccagcttcaa caactcttta acctccatga ttctggcgtt       300
     gaccaatcct taatcgacac gttacctgtt tttcattaca agtccattgt cggtctcaaa       360
     atctctcctt ttgattgtcc tgtttgtctc tgtgagtttg aaacagagga taaacttaga       420
     ctcttgccta aatgcagcca tgcctttcac gttgagtgta tcgacacgtg gcttctctct       480
     cactctactt gtcccttgtg tagatctaat ctcctctctg gtttttcgtc tcaccacaat       540
     ctaagctcct cgtatctact tgttcttgag agtgaacaaa gctcgagaga tatggttcct       600
     gttcttgagt ctaactctca actaggttat gatgtgaaca atgattctga gtcgacccgg       660
     attaggtcgg gtcgtaaatc atgtgacccg gatggtgaca tggatggttt agatgaaaag       720
     gttgttcctt tagaagttaa gttagggaag tttaggaaca tagatcatgt tggtgaagga       780
     agtgaccaga agaaaaatag cataagtggt aatagtaaaa atgtggatgg aaggaggtgt       840
     ttgtcaatgg gatcatatga gtatattatg gatcaagaag ctacacttaa ggttcatgtt       900
     tcgaccaaga aactatccgg aaaagaccgg gtgccgagcc acaggaccgt tatgtccgaa       960
     tgcggttttg atccaacagt taagggaatt gagaagagtg ttgtggagag ggagagcttt      1020
     tctttatcga aaatttggct aaggggtaaa aaggagaagc aaaaggggac tagtgctaga      1080
     gattcggatt gttctttcgt gtcttcctct tcactccggt ttccaaacca tcggattcct      1140
     cccgaagaga gtcttaagag cgaaaattcg gaatctttgg agacgaaaac gccatctttt      1200
     gctaggagga ccatgcattg gcttgcaggg agacaaaaca agattgttca gccttctaca      1260
     tccaatgtct ag                                                          1272
//

If you have problems or comments...

PBIL Back to PBIL home page