(data stored in ACNUC13479 zone)

EMBL: AC005724.PE4

AC005724.PE4         Location/Qualifiers
FT   CDS_pept        complement(join(11029..11303,11403..11508))
FT                   /codon_start=1
FT                   /gene="At2g18660"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:Q9ZV52"
FT                   /db_xref="InterPro:IPR007112"
FT                   /db_xref="InterPro:IPR009009"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9ZV52"
FT                   /protein_id="AAD08935.1"
FT                   /translation="MAVKFVVVMIVFAQILAPIAEAAQGKAVYYDPPYTRSACYGTQRE
FT                   TLVVGVKNNLWQNGRACGRRYRVRCIGATYNFDRACTGRTVDVKVVDFCREPCNGDLNL
FT                   SRDAFRVIANTDAGNIRVVYTP"
     atggcagtaa aatttgtggt agtgatgata gtgtttgcac aaatcttagc tccaatcgct        60
     gaagctgctc aaggaaaagc tgtctattac gaccctccct acactaggtc tgcgtgttac       120
     ggaacacaac gtgagacgct ggtagtcgga gtcaagaaca atttgtggca aaatggtcga       180
     gcttgtggtc ggaggtacag ggttcgatgc attggtgcta catacaactt tgacagagca       240
     tgcaccgggc gtaccgtaga cgtgaaggta gttgatttct gccgggagcc ttgcaacggt       300
     gaccttaatc tctctcgtga cgcttttcgg gttatcgcta atactgatgc cggtaacatt       360
     cgtgtcgtat acacaccgta a                                                 381
//

If you have problems or comments...

PBIL Back to PBIL home page