(data stored in ACNUC13479 zone)

EMBL: AC005724.PE5

AC005724.PE5         Location/Qualifiers
FT   CDS_pept        join(13342..13883,14322..14325)
FT                   /codon_start=1
FT                   /gene="At2g18670"
FT                   /product="putative RING zinc finger protein"
FT                   /db_xref="GOA:Q9ZV51"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9ZV51"
FT                   /protein_id="AAD08936.1"
FT                   /translation="MPPTNNYRISGEPPSTTPSHPPPKPKTRILSLFLVGVIMFSIFFL
FT                   FLVLIGIASVLILPLLLSSLHRHHRRRRRNRRQESSDGLSSRFVKKLPQFKFSEPSTYT
FT                   RYESDCVVCFDGFRQGQWCRNLPGCGHVFHRKCVDTWLLKASTCPICRARVRLWEEDPQ
FT                   EGELWRCFGHRRSSLLDL"
     atgcctccga ccaataatta ccgaatctcc ggcgaaccac cgtctactac gccgtctcat        60
     ccaccgccaa aaccgaaaac aaggattctc tctctattcc tcgttggtgt aatcatgttt       120
     tcaatcttct ttctcttcct cgttcttatc ggtatcgcct ctgttcttat cctccctctc       180
     ctcctctctt ctctccatcg tcaccaccga cgtcgtcgtc gtaatcgccg acaagaatcc       240
     tcagatgggt tatcttcaag attcgtgaaa aagcttcctc aattcaaatt ctccgaacct       300
     agcacataca cacggtacga gagcgattgt gtggtttgtt ttgatggatt cagacaagga       360
     caatggtgtc ggaatcttcc tggttgtgga cacgtgtttc atcgaaagtg tgtggacact       420
     tggttgctca aagcctcgac gtgtcctatt tgcagagcta gggttagatt gtgggaggaa       480
     gatccacaag aaggagaatt atggagatgt tttggtcata gaagaagtag tttgctagat       540
     ttgtaa                                                                  546
//

If you have problems or comments...

PBIL Back to PBIL home page