(data stored in ACNUC13479 zone)

EMBL: AC005724.PE6

AC005724.PE6         Location/Qualifiers
FT   CDS_pept        14767..15516
FT                   /codon_start=1
FT                   /gene="At2g18680"
FT                   /product="unknown protein"
FT                   /db_xref="GOA:Q9ZV50"
FT                   /db_xref="UniProtKB/TrEMBL:Q9ZV50"
FT                   /protein_id="AAD08937.2"
FT                   /translation="MTDPNTPEFAAHLMRVFVDFRQFVNSLYIFIAVSSIINLLSTLVM
FT                   VHASALTHKDDSFEIKDFPILTLKYWKGPLVTNFYIVLFSLGYWFLFFIVLFSIVFFST
FT                   KLDSLAAKSRALFIVFAVFESYLAIVWNLSMVISILEDTYGIQALGKAAKIVKGMKPKL
FT                   FLLNLFFGLLSFGLVQILRLVDWSSSFSVTLTTGLVLMSSVFVVRMFQLVTYTVAYFQC
FT                   KSLQGQDSLRDVEYTKLSSTTLMGGLP"
     atgacagatc caaacacccc ggaatttgct gcccatctta tgagagtctt tgtagatttt        60
     cgccagtttg tcaattcttt atacatcttc atcgccgtct cctccatcat caacctttta       120
     tccactcttg tcatggttca tgcatcggct cttactcata aagatgatag cttcgagatc       180
     aaagattttc cgattctgac gcttaaatat tggaagggac ctcttgtgac caatttctat       240
     attgttctct tcagtcttgg ctattggttc ctattcttta tagtcctatt ttctatcgtt       300
     ttcttctcta caaaactcga ttccttggca gccaaatctc gcgctttatt cattgtattt       360
     gcagtctttg agtcttactt agctatcgtt tggaacttat ctatggtcat atcgatactc       420
     gaggatactt atgggatcca agctttgggg aaagctgcaa agattgttaa agggatgaag       480
     ccaaaactat tcctcttgaa tcttttcttt gggttattgt catttggatt agttcaaatc       540
     ttgcggctgg tcgattggag tagttcattc tcggttacct taaccaccgg tttggtcctt       600
     atgagttcgg tctttgtggt gaggatgttt cagcttgtga cttacaccgt tgcttatttc       660
     caatgtaaga gcctgcaagg acaagactcg ctgagggatg ttgaatatac gaaattgtca       720
     tccactactc tcatgggagg attgccttga                                        750
//

If you have problems or comments...

PBIL Back to PBIL home page