(data stored in ACNUC13479 zone)

EMBL: AC005724.PE7

AC005724.PE7         Location/Qualifiers
FT   CDS_pept        17523..18491
FT                   /codon_start=1
FT                   /gene="At2g18690"
FT                   /product="expressed protein"
FT                   /db_xref="GOA:Q9ZV49"
FT                   /db_xref="UniProtKB/TrEMBL:Q9ZV49"
FT                   /protein_id="AAD08938.1"
FT                   /translation="MARFSFLNVVKDVVAILNESRKLFLKNKKLMFSVLVFPLLLNCLV
FT                   YFLNIFVIVPEITNLILEASLLPSTDPTSPEYAARLMRVFTDFRQFVGSSYIFAAVSSI
FT                   INLFSVLVIVHASAITLKDENFNIKDFPVLSLKSWKGPLVTYFYIALFSLGFGFLFFII
FT                   LCPILLFSIKSGSVENIGFLAVEAGVLLIIFTVSQSYFAIYWNLSMVISILEESYGFQA
FT                   LGKAAKIVKGMKTKLFLLNLFFGLLASGLAQILQLINMGRSLAVTLTTGFVLVCLVFAV
FT                   RMFQLVTYTVAYFQCKSLQGRDVESLRDVEYMALSSTTLTE"
     atggctcgat tttccttctt gaatgttgta aaggatgttg tggctattct aaatgaatcc        60
     cgcaaactgt ttctcaagaa caaaaagttg atgttctcag tcttggtatt ccctctctta       120
     ctcaattgtt tagtttactt cttgaacatc tttgtcatcg taccggagat cacaaacttg       180
     atccttgaag caagtttgtt gccttcgaca gatccaacct ccccggaata cgcagcccgc       240
     cttatgagag tctttacaga ttttcgccaa tttgtgggtt cttcatacat tttcgcggct       300
     gtctcctcca tcatcaacct cttttctgtt ctagtcatcg tccacgcatc ggctattact       360
     cttaaagatg aaaacttcaa tatcaaagat tttcctgttc tgagccttaa atcttggaag       420
     ggacctcttg tgacatattt ctacattgct cttttcagtc ttggctttgg cttcctcttc       480
     tttataatcc tttgtcctat ccttttgttc tctataaaat ccggttccgt ggaaaatatc       540
     ggtttcttgg cggtcgaggc tggtgtttta ttgattatat tcaccgtctc tcagtcctat       600
     tttgctatct attggaactt atctatggtc atatcgatac tagaggaaag ttatgggttc       660
     caagctttgg ggaaagcagc aaagattgtt aaagggatga agacaaaact gtttctcttg       720
     aatcttttct ttggtttatt ggcatccgga ttagctcaaa tcttgcagct gatcaatatg       780
     ggaagatcgt tagcggttac cttaaccaca ggttttgtcc ttgtgtgttt ggtctttgcg       840
     gtgaggatgt ttcagcttgt gacttacacc gttgcatatt tccaatgtaa aagcctccaa       900
     ggcagagacg ttgagtcgct cagggatgtg gaatatatgg cattgtcttc cactactctc       960
     acggaatga                                                               969
//

If you have problems or comments...

PBIL Back to PBIL home page