(data stored in ACNUC13479 zone)

EMBL: AC005724.PE9

AC005724.PE9         Location/Qualifiers
FT   CDS_pept        complement(join(32104..32334,32441..32604,32692..32905,
FT                   32987..33672,33755..33912,34123..34325))
FT                   /codon_start=1
FT                   /gene="At2g18710"
FT                   /product="putative preprotein translocase SECY protein"
FT                   /db_xref="GOA:Q38885"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q38885"
FT                   /protein_id="AAD08940.1"
FT                   /translation="MITVSEVSSYSSSSSNFASLSRLNHKSSSRLRSSSLYKGSFFSVS
FT                   TKTRRNTCKAKSWNLGLVINSRSSEASVFDPLGINPDETSGLSSIWESFVSLLSPSFES
FT                   SSGNRRDKPSSGRGVAAAIEDSSIDFGDFFKGPLPGKFLKLLGFLALSRLGIYIPLGGV
FT                   NREAFVGNLDQNSILSTLDTFSGGGIGRLGICSLGIVPFINAQIVFQLLAQVYPKLQDL
FT                   QKKEGEAGRKKILQYTRYASVGFAIVQAIGQVFYLRPYVNDFSTEWVVSSVTLLTLGSV
FT                   LTTYIGERISDLKLGNGTSLLIFTSIISYLPASFGRTTAEALQEGNYTGLGTIVVSFLL
FT                   LVLGIVYVQEAERKIPLNYASRYTSKAGGLQKSAYLPFKVNSAGVMPIIFSTSSLALPA
FT                   TLARFTGISALKNVAFALTPGGSFYLPTNILLIAFFNYYYTFLQLDPDDVSEQLKRQGA
FT                   SIPLVRPGKSTALFIKTVLGRISVLGSAFLAVLAAGPAVVEQITHLTAFRGFAGTSVLI
FT                   LVGCATDTARKVQAEIISQKYKNIEFYELDKYDP"
     atgataacgg taagcgaagt ttcctcttac tcttcttctt cttcaaactt cgcgtctctg        60
     tctcgtctca atcacaaatc atcttcgaga ttgcgaagct cttctcttta caaaggaagc       120
     ttcttctctg tttcgacaaa gaccaggagg aacacttgta aagccaaatc atggaatctc       180
     ggtcttgtta tcaactctag aagctctgag gcttcggttt ttgatccgtt ggggatcaat       240
     ccagatgaaa cttctggttt aagtagcatt tgggaaagct ttgtgagtct tttgtcacca       300
     tcatttgaaa gctcttccgg taacaggcga gataagccgt cttctggtag aggcgtggca       360
     gctgctattg aggacagttc cattgatttt ggagatttct tcaaagggcc attgccaggg       420
     aagtttctga agcttcttgg gtttttagct ctctctcggc ttggaattta cataccactc       480
     ggcggggtta atcgagaagc ttttgttgga aatttggatc agaatagcat tttgagcact       540
     ttggatacat tttctggtgg aggcataggt agacttggta tatgttctct cgggattgtt       600
     cctttcatca acgctcagat tgtgtttcag cttcttgctc aagtctatcc aaagttgcaa       660
     gatcttcaga aaaaagaagg tgaagctggt agaaaaaaga ttcttcagta tactagatat       720
     gcttcagttg gttttgcgat agtacaagca atcggacaag tgttttacct tcgtccttac       780
     gttaatgact tcagcacgga atgggttgtt tcttctgtta cgttgttaac gcttggttct       840
     gttctcacta catatattgg agagagaatc tctgatctga aacttggaaa tggcacttcc       900
     ctattgattt tcacaagtat catctcttac ttgcctgcat cattcggtag aacaacagca       960
     gaggccttac aggaaggaaa ctatactggt cttggaacca tcgttgtttc atttctcctc      1020
     ttggtactcg ggatagtata tgttcaggaa gcagagagga aaattccgct caattatgcc      1080
     tcgcgataca ccagcaaagc tggtgggctt cagaaatctg cttatcttcc attcaaggtc      1140
     aatagtgcgg gagtaatgcc tatcatattc tccacatcat ctcttgctct tcctgctact      1200
     ttagcacgat ttaccggcat atctgctttg aagaatgttg cttttgcttt aacccctgga      1260
     ggttctttct atcttccaac caatatactt ctcatagctt tcttcaacta ctactacact      1320
     ttcttgcaac ttgacccgga cgacgtgagt gaacaattaa aacgccaagg tgcatcaatc      1380
     cctctagtcc gacctggtaa aagcactgct ctcttcatca aaaccgtcct tggccggata      1440
     tcggttcttg gttctgcatt tctggctgtt ctagctgctg gtcctgctgt agtcgaacag      1500
     atcactcact tgacagcatt cagaggattt gcaggcactt ctgttctgat ccttgtcggg      1560
     tgtgcgacag atactgcaag aaaggttcaa gcagagataa tctcgcaaaa gtacaagaac      1620
     attgagtttt acgagcttga caagtatgat ccatga                                1656
//

If you have problems or comments...

PBIL Back to PBIL home page